SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_049782636.1.69417 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_049782636.1.69417
Domain Number 1 Region: 746-1179
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 6.43e-46
Family alpha-mannosidase, C-terminal domain 0.017
Further Details:      
 
Domain Number 2 Region: 323-691
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.82e-25
Family 4-alpha-glucanotransferase, N-terminal domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_049782636.1.69417
Sequence length 1204
Comment hypothetical protein [Maribacter sp. HTCC2170]; AA=GCF_000153165.2; RF=na; TAX=313603; STAX=313603; NAME=Maribacter sp. HTCC2170; strain=HTCC2170; AL=Complete Genome; RT=Major
Sequence
MKNECKSHALKAIIVFCLAMLAYGNSYADKRNLFTEKRELVPFHEGNGNGHIQELNTNYG
LYSVCKDDIEGYKEMLSGSEFFLYPSLREDVNVSMIARATTGEMGFEFLTGEVPSDYASD
TVTFFMLSDIDFNLRESFDIHVNDKHLLTFNSNEDGTLSVTDNPGKGNAQYILVNRDGNG
DGIGAFRLTVPISLLEKGKSAKIKFNGHKKNSNCWVMIFKATDAVERIKMSISDEAAFMI
KQKNEMLYVDAPTHFNDKKVYLISDGKKSKVRKFKAQGEISKASFSIAPPKKSFSIVYEG
REIVLDFEKGDGVLSKTDIDGKYLYHHRTNYVNGWVAYLTKLYKPEFLETYNDFFDKKYD
NGLVSIMNSSHQDIAWVDRPEICIILRDTLLLKPVLKDAFIRDDYGFDIEDGLMLREYIE
RHPESVEKLTTLLNKKLISVGATYNCPYEDMYDAEDQVRQLYLGKKWVKKTFGGYDSKVY
WNVDVPGKSLQTPQILKKAGVDYMIISRHAKGLFHWASPDGSSVFTYSPGHYGNDLLYLS
RDLNNKMKYGAEQVLYWEKNFEGSEIQTPLLSSQDMLPAIDYSEFIESWNSFDSLKDEKG
TEKNVHLPKMELMTVDEFLPLAEKKATKIDTIMGERPNVWVYIHGPGHHDALTASREASK
LLPAAEKFLTVANIIDPKKMQYPFKEFDEAWQAKIYPDHGWGGHDGDITDNLFKENLVKS
RTMGQNLLNKGLDFLSTRIKKNEKLGTPIVLFNSLSWERTDPVTTTVQIPQGETKNVGVL
NAKKKIVASQISNAAYYKDGSLKSADITFIAENIPSIGYATYYLANKKNTVEDKANNVST
SAYENPFYKITFEKGGIEQVYDKEFKKELLEADNLRGGEIFTLQSVGNGAGEFGDVQQVS
MVDFDKMSLHNPEWEVLENGPVFTKYRLEQEIKHAIVRQDVILYHNLKRIYFNTELRNWS
GELYREFRTAFPINMDSPEIAHEVPFGSVRVGKDEIKTAGERYTPLCKDVHPRAIIDWIS
ATDDEVSVTLSSSVAAADWIDPTSHDDSKVVLQHILLASRTSCHWEGNEYSQAGNHKFHN
VFTSNKAGSINGQRIAKQENEPINVVVYPDSSTKSFLPESLSFFSIDTDNVMISTIKKAE
DSEEIIARMYNVWEDNEKVNVSSYFDINSYKHTNIIEENPTPVAPELKVGKYAIETFSLD
ANKK
Download sequence
Identical sequences WP_049782636.1.69417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]