SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_050459351.1.87772 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_050459351.1.87772
Domain Number 1 Region: 1568-1860
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 7.2e-27
Family Terpene synthases 0.029
Further Details:      
 
Domain Number 2 Region: 525-756
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.08e-26
Family Quinoprotein alcohol dehydrogenase-like 0.0028
Further Details:      
 
Domain Number 3 Region: 759-927
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.76e-22
Family Quinoprotein alcohol dehydrogenase-like 0.0042
Further Details:      
 
Domain Number 4 Region: 938-1009
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000562
Family PKD domain 0.0028
Further Details:      
 
Domain Number 5 Region: 308-415
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000916
Family PKD domain 0.0044
Further Details:      
 
Domain Number 6 Region: 437-517
Classification Level Classification E-value
Superfamily PKD domain 0.000000000102
Family PKD domain 0.0017
Further Details:      
 
Domain Number 7 Region: 1024-1095
Classification Level Classification E-value
Superfamily PKD domain 0.00000576
Family PKD domain 0.0068
Further Details:      
 
Domain Number 8 Region: 1102-1183
Classification Level Classification E-value
Superfamily PKD domain 0.0000667
Family PKD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_050459351.1.87772
Sequence length 1952
Comment cell adhesion protein [Haloferax gibbonsii]; AA=GCF_001190965.1; RF=na; TAX=35746; STAX=35746; NAME=Haloferax gibbonsii; strain=ARA6; AL=Complete Genome; RT=Major
Sequence
MTTRYRHQVGAASLTIIVLVSLASPFVALSGAAAGQSLAGSVDRATGAPAASDVVFAATD
GSEPSYDELSAQGAYNLTGLQSNATYDVSYLAANGSQPGAPGAFPRDGSPDVFALQRASP
GATADLGNAALPGAHVVNLSVVNETGAPVSGAAVAFQHTNANGATVNTSQFGEWFLTEAD
GDVHLSNGTAGIELTGNVTVAVAPPRQLSYDGGLEGEPVSSSSGYVQRVYTTQLDVTGDE
TVTVTLESAEQPGATMTANETAPALGEPVNVSLSNITGETPSFYTWTVDGSYAGYTTHPN
ASLVLPGFSAPGPHTVAVTARSGSEQFLFEESLTLDAVTAGDGTLTAAPTPARANLDTVR
FALVNVSGVGDGDFYTWTFGDGDRAYTRHPNATANHTYAEPGAYNATVRVRDNSTEALLV
EDTLRLDVTAAGNGTLVATPDSLTEGESVAFAVRNVSLAAGQSVGEYRWDFDGDGTADTT
TAANETSHAYADPGTYDAAVTVANANGTPLFTASAAVEVAAEEFAAPTDGWPQFGYDDAN
TGANVAGVGPAGPVEVRWNETTSTLYSRPPTFADGRVFVASGYGIVAYDAANGSTLWSAS
AYPDEVTAPPTVEGDSMFVSSHNDAANNERDTLTVFDAADGSERWSVSVLADSDGLFTDG
EWLSAPTVTSDAVYVVSEAEDALYAIDRGSHSLRWRKNLTELETTGDAQAVPAVANGTVY
VTQGWDGSRFTGFGSHLYAFDADTGTERWNRSLSNHRGAAPTVSDGVLYVSTYGSLVAFD
ADTGAQLWSVAAGETESRSSPAVADGIVVDTRGGFYDDEKGVVAVATNGSRAWSYDTDSA
VLGAPAVLGDTVYVAEFDGTVHALDLQTGAPVWNDSLDAPGFDTTVASAVVGGDGWLYVQ
TGSSSDINRSLVALGDVEPLASVSGSLSATPADPRRTVENVTFETTVSGDADSVETYRWS
FGDGATAETTARNVSHAYDRTGTYTARVSGFDSYDRKLYTATTAVTVRDIGSADLRVAPT
PADVNVTNVSFAVTNRSLPASVTDVRYGWSFGDGETVFTSANRTNHTYAALGDAPVSVEV
LDGTTEQTLVTLSTTVPVVDRVPPTVSASAPSPVRTGGNFSVVASATDNHRVANYTFETD
EGQSVTTAANRTNLSLATAGAHTVTVTATDASGNSNATTLVVNASAAPDLEPRISVEPAQ
TLGNDRVTANVTVVNDGTAEATDVDVRLVARSRVGYYDDASTTYTRAVGTVAAGANETVT
VDLTDWLRGNLSSAYPDVELVAVTDPDGAVAEGDETDNRTTATTEVSYADLRLTVNAPWR
VIPTEAAETRVYVRNYGNAPSDARTAELDFGDGSSNETLAVPSLDPRETAVFTRNHTFAT
GRHTLVASVADPDAPRGNADRDVTTSQPYELRGRLSAADPVQVGRNVTVYGRGYSNYESN
VTANLSLPAGLEFAPGETATKYDTDDRTYFEWTVVATANRDATYDLELNLSARGENETAT
ERLTVERPKTRVVDTAAVNFTGTGSDSATLTLRNETTYEHGVTISTHLGTDGRTLAGLDY
LVEYPHACVEQTTSPMLGALYTGQYYRRNPAPGGYDTGQINASVGAGVARLTTGQDAQHE
NGSWSMYGNDPDGDVFYTAYALFGTSAVGNDPVQSARAPVRADLDRIDANATVAWLADEQ
AADGRIRNDKFYFDDDAAMTGFTLVALDQAGPYNATAAATADQLRGDAASYLVTAQRADG
AWGDGSTPNTMSTALAVWGLEASGVETAPVRTAIDDGRAWLLDNQADSGAWSQRRSASWS
DVGTTSETTAYALMALNATGLENTNASVQAGQTYLVTVYDDRGSWGYTRATALAINTLLT
LGQGGSTPTHDVTVTFGTESTPALVTKTIDVDSTDALDSVELTDSELQTLRDNADGPITV
QVDTTGTGVLVVGLENDQLVARDEYAANEGGP
Download sequence
Identical sequences A0A0K1IUB1
WP_050459351.1.87772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]