SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_050701577.1.57479 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_050701577.1.57479
Domain Number 1 Region: 119-203
Classification Level Classification E-value
Superfamily PKD domain 1.83e-22
Family PKD domain 0.0015
Further Details:      
 
Domain Number 2 Region: 232-548
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.73e-17
Family Quinoprotein alcohol dehydrogenase-like 0.0065
Further Details:      
 
Domain Number 3 Region: 32-114
Classification Level Classification E-value
Superfamily PKD domain 9.81e-16
Family PKD domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_050701577.1.57479
Sequence length 580
Comment hypothetical protein [Dysgonomonas sp. BGC7]; AA=GCF_001261735.1; RF=na; TAX=1658008; STAX=1658008; NAME=Dysgonomonas sp. BGC7; strain=BGC7; AL=Contig; RT=Major
Sequence
MKKYSIIILSLIAMTILHSCSDEDNNLDLGKIPETTFKTDKESYTIGETVYLFDNTPDED
NIESYYWHFGIEGSGSYSIDKNTSITYTRPGTYIVKLTVTNKEGGYKTSEKEIVIDRVNE
PPVADFILSPTVSVIGSIVTFTDKSEDDGTIVSWLWEFGDGATSNEQNAEHVYSHGGFVK
VKLTVTDDKGLINSREKTILVRSSLTPGVLEILWTKTFETSSKLRSVSPAVGDNGNIYVT
SNGLKLYSYSPDGTQSWMFDLNKSGAVGNQESSPAVDTDGTIYVGVGQGTGSTNAYLYAI
NPDGSQKWEYLIGVGARVAYTSPVITADGNIAIGNRGSGGSLRVVDRNKNQQWSTTPSGG
VGGGLAADKSGNIYSGSTGTYGFASSKDGKVSTNYLGSGYSANGTSPAIDENGNIYMGLN
NGSIGTLVSYNDQGNKNWEFATTGSISQGGPAIGADGTIYIGSTGGKLYAVSKGGSQKWS
YTNPYDITCVPAIDSDGYIHITDEGGYYTILDASGTMKQQVKLGSKIWSSPVISDYGIIY
ITVEDGDACKLVAIDFGVKGPANSSWAQRGQNARRTFLQK
Download sequence
Identical sequences WP_050701577.1.57479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]