SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_050723023.1.92826 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_050723023.1.92826
Domain Number 1 Region: 120-317
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 5.11e-21
Family alpha-mannosidase 0.074
Further Details:      
 
Domain Number 2 Region: 562-1007
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.51e-16
Family alpha-mannosidase, C-terminal domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_050723023.1.92826
Sequence length 1038
Comment hypothetical protein [Microbacterium sp. GCS4]; AA=GCF_001262495.1; RF=na; TAX=1692239; STAX=1692239; NAME=Microbacterium sp. GCS4; strain=GCS4; AL=Contig; RT=Major
Sequence
MKPSLISASPWTGEEAREGLLHRATAAVATIGTHVVRVIPEPLQRQAGGQSARSVRVVIE
GDRAADVEALDVQIEDAAGGSLGIERATAPAGSVRVLVPASADPVDAVVRVPALGDESIA
VRLDGVRPWSVHVVHHSHFDFGYTDPQAAVIANQRSYLDSAVELITRTADWPEESRFRWN
AEALWSFDDWERHRTPAEIDELVRLVKEGSIGLSAMPYNLHTDTCSTDELHELLASARRI
RDQYGIEFRSAMQTDVPGQVAGLPDALSDLGVRYLAVAHNWAGRSEPHRNGGLDNPRMFR
WRSPAGKSVLVWMTDSPHGLAYIEGPMVGFTESFETLETVFSAYLTALSTKGYPFPPGVF
GAHGEEDPGRQPYPWDVLHVRTQGFMGDNGPARLHLSEQVRQWNETWEYPRLRVSRNEDF
FEDAEARYGDELVTFEGDWGDWWVEGVGSGAVPLALAREAQVAAPVARSISQLSRWSGGD
PVASEGADARAAYDAISMFNEHTWGASNSWTHGDEGYDSGERQWQWKVGHAIAAHQRTVD
STELALHHLGRAVAPAPDALASYVVVNVAGHARSTTARVLVKESQVPLDAHVAVVDARTG
DVVPHTVEDQGNSLHRESGRWITFPVTDAPEVGWVRFDLVPAEEPAAAPTVHPLQTGRRE
DILVLENEHLRVEVDDRRSVIRSLVEKATGRDWVNRESFAGFNSYIYDTYGSSGAGVNHL
ANKLSVSPRLELLASRTVGRPAVIVERVDDAVEQRLVYEFPADGVDAVRVTLRLRHGDPT
LLIENRVSKPVTRVKESGYFAFPFAADDPAVRLEVSGGVTGDGIPHVPGAPQHMRAIRNW
VTVADRDDAVVWATKDAPLVQTGTIALPYAPFPASTAPDEPSTVISWFHNNVWDTNFPIE
QGFTATFSYAIGVRAVESQSVEGLAVATASAVARPVVAIPAAGRGASEPTASFLHLDDDR
IAVIGVGTADEPGWSRVRLQSFADVQARVRVALEGMDAARRATLLGDPLGDLTVVDGAVV
LELAPFETAAIEARISDR
Download sequence
Identical sequences A0A0L6HVG6
WP_050723023.1.92826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]