SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_051324102.1.99779 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_051324102.1.99779
Domain Number 1 Region: 86-286
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.04e-18
Family alpha-mannosidase 0.032
Further Details:      
 
Domain Number 2 Region: 547-789
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.24e-16
Family alpha-mannosidase, C-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_051324102.1.99779
Sequence length 971
Comment hypothetical protein [Solirubrobacter sp. URHD0082]; AA=GCF_000425945.1; RF=na; TAX=1298857; STAX=1298857; NAME=Solirubrobacter sp. URHD0082; strain=URHD0082; AL=Scaffold; RT=Major
Sequence
MSRAIADPPHDVPPREDLAAYAGPVCGLPLFRSRGGRLEQAVRVTGAATIAHEGTVLDRT
DGPGLLFVPELDAPRAFAVTLDGVEHRVVLAPQRKWEVSVIHHSHLDIGYTDHQPLVLAQ
HLAYLDAALDLTTQDDGFRWNVEANLPLTRWLATRPGADREAFLARVRERRIEVCALPYT
MHTEAYSLDELARTLRPAQALRERFGIEIVSAMQTDVPGATLALCELLAAADVRYLSVAH
NYAGRSVPHLNGGQSLRRPFWWRAPSGRRLLVWHTDSPHGIAYMEGNLAGLAEGYEATLE
YLPAYLHALATRPYPYGAGTTGWLTGIAAGTELTRAPQEHELLHLRVQSAFADNAAPSPV
PAEIVREWNASWAYPRLTMATNRDFFEAAQKRLGDSIPTYEGDWTDWWADGIGSAAREVA
VARRAQRDVRTAQTLHAWADALEAAGDPRGAAASGASPAPATPGASPGWPAEVERAYEDL
GLFDEHTWGAANPWRDRLEHVDAGALQWQWKAARAHAAGETAGALLESAHARLAAHVPRH
AGALAGVLVFNPSGVARTDAVELLVPETRVPLSASLTVVDVASGERVPCELAPQPHADYR
PRGRRLRFLARDVPAYGFARYALAGGRAGVRDPVPGDPAALESAGLSAGLDARSGCLTSL
GDLVNPDSAFGNQYVYDRYATASRVNHLSSRIGEPGLWLLASRDVAGDGVLVERTSSALQ
ERATVRLRAPGAHALTVTYRLVHGAGRLEISNVVDKAPVTDKEAVFFAFPFARENPRVRY
ELTGGVHAQGDPTVPGSAPHMRAIRDWIALDDAVLATFDAPLVQVGGIHLPYAPFPLTTQ
REPGTVFSWAMNNGWDTNFPQSQGGEVELAYAVGGAGPPLTAILSSPRAADGIPERGTLC
TLPEGIELIAISAGRAGGLVAQVRSRAAGPVELDAAFPDLPVTARAVGDHLERPRGATAI
LPGELLTIALA
Download sequence
Identical sequences WP_051324102.1.99779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]