SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_051685759.1.57295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_051685759.1.57295
Domain Number 1 Region: 115-424
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.84e-56
Family Carboxypeptidase T 0.016
Further Details:      
 
Domain Number 2 Region: 525-639
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000798
Family PKD domain 0.002
Further Details:      
 
Domain Number 3 Region: 645-719
Classification Level Classification E-value
Superfamily PKD domain 0.0000000641
Family PKD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_051685759.1.57295
Sequence length 753
Comment hypothetical protein [Rheinheimera texasensis]; AA=GCF_000711985.1; RF=representative genome; TAX=1123055; STAX=306205; NAME=Rheinheimera texasensis DSM 17496; strain=DSM 17496; AL=Scaffold; RT=Major
Sequence
MLISSLAAVWLNAGLAAAPHQSAAQLQQLQQLSSDNARIVRFASPEQARLAAISLHDALL
GGRWQDSSLILQLDAATEARLAPYAESIHPAYLWQQQQAATAAQPLTDSAQSIPGYACYP
TVEETYSQAEQLVRDYPDYASWHKIGSGWAKTKTGTGYDLYVLKITNRNSGAANKAKLLV
NSAIHAREYATAALTLEFAKDLLGKAGKDADVDWMLAQNEVHLVLQTNPEGRKIAETGVS
WRKNINDTACNSATFGVDLNRNFSFGWFAIPNGSSGNSCDLTYRGVSAGSEPEVQALEQY
ARSLYPDKRGPARTDAAPDNTAGIHIDVHSYSELVLWPWGDTTTPAPNGPALKALGHKLA
WFNNYVPTQSIGLYPTDGTSDGVSYGELGVAAITFEIGTAFFESCANYQANVLPDNLRAL
YYALRVNTAPYLLPAGPDVSQLSLNTTANQIPRNVPLQLKALVSDSQSSGYNGGVASQVI
QSVELTLDQWPDLAGSSSISINATDGKFDSANETISHSLDVSGLSEGRHTLYLRAKDSAG
NSGPVYAGYFNVTAPVVVKPPLPDFTVECQFLRCQFRNTTPGDATLPLEFSWTFAEGATS
TAKDPVYTYSAAGTYQPVLRVTMAGQTEQRSKALQVFAEPQLQLSSNCQNLSCTLTASAS
SANGPVGTVQWSVNNQTLNGQSVNVTFGAAGTYQALAEVSDSAGQKVQKTLSVTVTAPVV
VTPAEPAAKSSSSGGSVGYVSLLLLCILRRRLV
Download sequence
Identical sequences WP_051685759.1.57295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]