SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_051877917.1.75928 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_051877917.1.75928
Domain Number 1 Region: 518-945
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.96e-33
Family alpha-mannosidase, C-terminal domain 0.023
Further Details:      
 
Domain Number 2 Region: 105-125,155-412
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.0000000000482
Family alpha-mannosidase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_051877917.1.75928
Sequence length 947
Comment glycosyl hydrolase [Flavobacterium gilvum]; AA=GCF_000735535.1; RF=na; TAX=1492737; STAX=1492737; NAME=Flavobacterium gilvum; strain=EM1308; AL=Contig; RT=Major
Sequence
MFATILPTEAVECLVQPVYRFRKDKTPGREIIIKLKEGKLEGKIAVDITAGKTKETTEFL
DKKEGYSELSILLPNTIGVKSDATVTIVIRQGKNIIKKTVNVPTMRHWNVYLYNHAHVDI
GYTNTHKNVELLHKNNILEGIKLAEKTKTYPKGSQFVWNPEVTWPLERLWETQPEERTNV
LNAIKSGFISVDASYSNTDTSVCSDEELFHLFNFSRKIQRLSGKPIDVFQQMDVPGISWG
IIPVLNQQGIKYIMAWPNTDRAGFSHEGLDKKPLWWVGPDGKSKVLFLQPGQYANSGSMD
KGGATGRPWFGQRDPQKVPLYIQTGDANVDFTKKLVDMEAEKYPYDFLVLSWSLWDNNPL
DADIPDAVKKWNETHAYPQIIISGGHQIMEMIDKKYGDKLPVVKGDYTEFWTDGLGTAAK
LAAMNRKSKEILTQSETLWSMLHPAKSAPRNEFEEAWRKIILGSEHTWCFEDPNDSYFQD
AIFKVKKGYFIDAHERSIDLMDEALAPATEQANKTVPSGIAVFNTHSWNQSGTVTLSKEE
SGLGDKVVDDKGNPIPSQRLSTGELLFIASDVQALGSKHYRIEKGNSFSTKGCTINGTTL
ENSKVKVVVDEKTGNITQLIDLSTGQNFADTKVNGGLNAFRWLPGNVDAPKADTDISIKI
TENGPLVVELTISSKGEGCRSISRSVRLINNAKWVEINNVVDKLPLMEKDGIHFGFGFDV
PQSKTRVDIPWGIMEVEKDQWAQGNRNWIAMQRWLDVSNDKKGITWCSLDAPLFEYGSMT
ANIALGWGWGSKAPWVKKLEPSSTIYSWVMNNHWFTNFPLTQDGPVSFRYRLMPHGEFNP
LEANRFGLEQSQPLVHVLTEKDPKTKQLLTIDNEKVIVTILKQSEKEGEMIVRLRSLSDK
TETAKIGFPSISPKSVNVCEIEENAGASVSNSVSILPYGMMTIKVQF
Download sequence
Identical sequences A0A085EEZ3
WP_051877917.1.75928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]