SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_052006024.1.39475 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_052006024.1.39475
Domain Number 1 Region: 5-106
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.48e-29
Family Methylesterase CheB, C-terminal domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_052006024.1.39475
Sequence length 113
Comment chemotaxis protein CheB [Caballeronia grimmiae]; AA=GCF_000698555.1; RF=na; TAX=1071679; STAX=1071679; NAME=Caballeronia grimmiae; strain=R27; AL=Contig; RT=Major
Sequence
MLLADGSIALSSAPKENFTRPAADPLFRSAAVNYGNRAVGVVLTGNLEDGASGLKAIHAC
GGYTIIHDPTTCVALDMPQAARKAVPADVVAPIEDIGPAIVKALTDPSSKGLR
Download sequence
Identical sequences A0A069NGK0
WP_052006024.1.39475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]