SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_052019546.1.43688 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_052019546.1.43688
Domain Number - Region: 55-146
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0068
Family Capz beta-1 subunit 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_052019546.1.43688
Sequence length 196
Comment hypothetical protein [Bacillus boroniphilus]; AA=GCF_001315165.1; RF=na; TAX=1294265; STAX=308892; NAME=Bacillus boroniphilus JCM 21738; strain=JCM 21738; AL=Contig; RT=Major
Sequence
MKKINDSELGIRAFYDSTADKVVMERTVTGDFNKDPHTFLGAEIGYNGTNAGFIANVLQM
KAGAESPAGSGVWKTTETGGTNAKFTYNSSLTVEPPTNEYKINNIQFNFKQVTAGEETVT
VGNNTNAAFDSIVKFVNKYNEMIEKINGKLDEKRYRDYQPLSDDEKEVMEEKQIELWEEK
AKSGLIRNDSTIQWIE
Download sequence
Identical sequences W4RID7
WP_052019546.1.43688 WP_052019546.1.86257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]