SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_052037468.1.83591 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_052037468.1.83591
Domain Number 1 Region: 60-246
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 7.85e-53
Family Methylesterase CheB, C-terminal domain 0.0000732
Further Details:      
 
Domain Number 2 Region: 330-523
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.46e-50
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00023
Further Details:      
 
Domain Number 3 Region: 884-1007
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.32e-23
Family Heme-binding PAS domain 0.017
Further Details:      
 
Domain Number 4 Region: 265-332
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.000000000000196
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0043
Further Details:      
 
Domain Number 5 Region: 767-885
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000227
Family BphP N-terminal domain-like 0.072
Further Details:      
 
Domain Number 6 Region: 700-769
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000174
Family Tropomyosin 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_052037468.1.83591
Sequence length 1214
Comment hypothetical protein [Rhodomicrobium udaipurense]; AA=GCF_000636015.1; RF=na; TAX=858455; STAX=1202716; NAME=Rhodomicrobium udaipurense JA643; strain=JA643; AL=Contig; RT=Major
Sequence
MSHDALALILGEIHLKILRPIIMTEHKPRRKNGGGASNKAPPVSKGGDALRAPRNENTSS
PLIVGVGASAGGLEAFTAFFENMPPDSGMAFVLVQHLAPDHKSMLAEILGKTTAMPVTEA
ADGTEVLPNQVFVIPPDATLTIANGRFVVVKPAPPREVRRPIDTFMFSLARDQGENAVCV
ILSGTGSDGSLGLGSIKEHGGLTIAQAEVDHQAKLGMPRSAAATGFVDHVLQVKDIPAKL
LDYHRHLAQAKAHKNAEGIRKDAVEHLAEIATLLHSAVGHDFSEYKEKTFVRRVQRRMQV
LNLDSMNGYLEELRGNPKELELLFRDLLIGVTQFFRDPAAFEALEAKVIPALIAGRGADD
QVRVWVAGCATGEEAYSIAILLMEAVAKLPSAPRIMIFATDIDDRAIAHARAGRYPGALL
DAVSPQRLERWFVREGNHYAVSSELRESIVFSVHSVLRDPPFSKLDLISCRNLLIYLDTA
LQDRLIPIFHYALRPGGYVFLGPSESIARQEHFFTEVDKKHRLFERRNDTPAALPSLPLS
SAASRGMAPSSAGTPNRRAAESGVERGARRVMERYAPAHLLVDQKHQVLSFSGQTGKYLD
PQPGAASFNLFNLIQNALRPAARSLFQKAAATGLRAVQENVAIEVAGKSDSINLIVEPVL
PASGKATHYIMIFQDIEPPKEPAEVPDMEDRGIGSRELEAELRAIRARLQAALDEAEQAN
EDLKSANEEYQSLNEELQSSNEELETSKEEMQSINEELQTVNNELSEKNTSLHRLNSDLQ
NLLESTDIAILFLDDALCVRTFTAACTKLFHLREADRGRPVIEIASRLSYHAIEADVRSA
LAALSVVEREVHTPDNGTTFLMRIRPYRTLNGVVDGVVITFVDISEQKRHQETLARLAAI
VESSDDAIIGHSLEGVISSWNRGAEKIFAYTAEEIAGKPLSLLVAAGDKDEMPGVLERVK
TGEAVQSYETLLAAKDGQRIHISLTVSPVRNADGSIIAASIVARDVSERVRSERQRDLLM
KELDHRTKNTLSTVLAISRETARYATTLAEFGDAFQARLLALSKTHNLLTASHWEGASLR
RIFALELSPYGREGAEPRFALDGETVNLSPGQALMLGMAVHELTTNAAKYGALSTQSGRV
DVTWSVDRAETEDLLRLRWVESGGPPVKPPTRQGFGSHLIEKGLSLETRGEVCMDFAPTG
LRCAIAIPLKRAEN
Download sequence
Identical sequences A0A037UTX9
WP_052037468.1.83591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]