SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_052184634.1.71930 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_052184634.1.71930
Domain Number 1 Region: 674-1079
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.03e-32
Family alpha-mannosidase, C-terminal domain 0.022
Further Details:      
 
Domain Number 2 Region: 277-579
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000233
Family 4-alpha-glucanotransferase, N-terminal domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_052184634.1.71930
Sequence length 1108
Comment glycoside hydrolase [Chryseobacterium sp. YR459]; AA=GCF_000799235.1; RF=na; TAX=1500292; STAX=1500292; NAME=Chryseobacterium sp. YR459; strain=YR459; AL=Scaffold; RT=Major
Sequence
MYNRYFILLVSFLISNIAYGQKKVPYFGNIQPINGYNREITGENIDYFSAFPDHATRALL
TRTTDGAKTIEWETAPAPQKNTGPYVYFSWLVSHSSGTSGGIRNFDLYINDQKALTLSTY
PANQRPDWISKAADSTAFVFHQTKMDGLKDSYGIAYLRVPISKITPGKPLRLKLVGQAQN
SRDWFMTYKFTFEEKIDASSTPFILKDGKRLINLTTLHFGPDQKITATIDGKNNHSFTMP
DGIKTFDIPVTLSSEGGAVQLVVTSGKKELLRKNIEAGKVVPRTLYFIHHSHTDVGYSHL
QAEVEKIHTQNIYDAIKMVEETKNLPEETRFKWNVEALWDVENFMKNATAEDKKSFVKAV
KEGGIGLSAMYGNILTGLSQPEELFHYTEYAQKLEKEFGLKINSAMMSDVPGFAWALVPA
LTSSGVKYFSSGPNYLGKTNPYLGDRVGNFVKKWGDKPVWWQSPSGKEKILFWTAGRGYS
SWHGVHPGAVFETGQKKIAEYLNDLTQNNYPYDMVQWRYNIVADNGPIDPSVSRFVDEWN
KKYTSPKIILSTNEKMFEVFEKKYGDQIPVVKGDISPYWEDGAMSTAKEEGINRNSSLKL
QQLTTLYAMLNPAQYNHQGFYDAWRNVILFHEHTWGAFNSITAPDLPFVADQWKVKRQFS
LDGNSLAEKLEKELLQPLTDPSSKTIAVFNTSSWTRSGMVTIPETVLGNAVQDISGNKIS
LQKLQNGTMVFFAKNIPALGSATYTVIKNKAATPNSFTITDTGISNGKVSLTWDLKTGSI
TSFTDNNSTNYAGSFNDQGLNSYWYVPGSDPKEAVSNTDVKVKVLENGPVIAKVSITSEA
PGAKKLERIITLTAGSDEVALENIVDKKPVRTKESVHFGFPFNADFKNITIDAGYGTMKY
LTDQLPGSNMDYWYSRRWVDASSAQKGMQWMMLETPLIEPAEMIDERMTIDNSHKKWKDK
GTPGTTHWFSYAMNNYWHTNYKADQEGPVHYHYTLRPHEAFDAVENEKSATAFTQPLIAI
PLKEKSLAGKSLFRMNNDNIVVTSVTPQEDKGFLIRLYNPSEKEQTAAFLWEQLKPSKIT
ELKSGKVLSPDEKISLSGMDVIEIRIAL
Download sequence
Identical sequences WP_052184634.1.71930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]