SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_052186341.1.26623 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_052186341.1.26623
Domain Number 1 Region: 675-953,987-1069
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.61e-28
Family alpha-mannosidase, C-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 284-578
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.0000000119
Family 4-alpha-glucanotransferase, N-terminal domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_052186341.1.26623
Sequence length 1108
Comment glycoside hydrolase [Chryseobacterium sp. YR480]; AA=GCF_000799325.1; RF=na; TAX=1500296; STAX=1500296; NAME=Chryseobacterium sp. YR480; strain=YR480; AL=Scaffold; RT=Major
Sequence
MYNRYFLLLVSFLISNIATGQKKVPYFGNVEVINGYNREITGENIDYFSAFPDHATRALL
TRTTDGAKTIEWETAPVPQKNTGPYIYFNWLVSHSSGTSGGIRNFDLYIDDQKALTLNTY
PANQRPDWISKAADSTAFIFHQTKVDGLKDSYGIAYLRVPVSKITPGKPLRLKLVGQAQN
SRDWFMTYKFTFEEKIDAASTPFMLKDGKRLITLTTLHFGPDQKITATINGKDIHSFTMP
DGIKTFDIPVTLSSEGGSVQLVVTSGKKELFRKNIEAGKVVPRTLYFIHHSHTDVGYSHL
QAEVEKIHTQNIYDAIKMVEETKNLPEEARFKWNVEALWDVENFMKNATAEDKKSFVKAV
KEGGIGLSAVYGNILTGLSQSEELFHYTEYAQKLEKEYGLKINSAMMSDVPGFAWALVPA
LTSSGVKYFSSGPNYLGKTNPYLGDRVGNFVKNWGDKPVWWQSPSGKEKILFWTAGRGYS
SWHGVHPGAVFETGQKKIAEYLNDLTQTNYPYDMVQWRYNIVADNGPIDPSVSRFVDEWN
KKYTSPKIILSTNEKMFEIFEKKYGNKIPVVKGDISPYWEDGAMSTAKEEGINRNSSLKL
QQLTTLYAMLNPAQYNHQNFYDAWRNVILFHEHTWGAFNSITAPDLPFVADQWKVKRQFS
LDGNSIAEKLEKELLQPLTDFSSKTIAVFNTSSWARSGMVTIPETAWGNAVQDIAGNKIP
LQKLQNGTMVFFAKDIPALGSKIYTVTKNKVITPNSFTVTDTGISNGKVSLTWDLKTGSI
TRFTDNNSTNYAGSFNDQGLNSYWYVPGSDPKEAVSNANVQVKVLENGPVIAKVSITSEA
PGAKKLERIITLTAGSDEVVLENIVDKKPVRTKESVHFGFPFNADFKNITIDAGYGTMKY
LTDQLPGSNMDYWYSRRWVDASSGQKGMQWMMLETPLIEAAEMIDERMTIDNSHKKWKDQ
GTPGTTNWFSYAMNNYWHTNYKADQEGPVHYHYTLRPHGVFDAVENEKSATAFTQPLIAI
PVKEKTPAGKSLFRMNNDNIVVTSVTPQEGKGFLIRLYNPSESEQTTAFIWEQLKPSKII
EFKTGKVLSPDEKISLSGMDVIEIRIVF
Download sequence
Identical sequences WP_052186341.1.26623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]