SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_052244826.1.21834 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_052244826.1.21834
Domain Number 1 Region: 189-373
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.24e-53
Family Methylesterase CheB, C-terminal domain 0.0000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_052244826.1.21834
Sequence length 384
Comment chemotaxis protein CheB [Mameliella alba]; AA=GCF_000807715.1; RF=na; TAX=561184; STAX=561184; NAME=Mameliella alba; strain=UMTAT08; AL=Contig; RT=Major
Sequence
MSVKSVVIATPDAAQRKRLGLVVDRMSEFEVIAQTGDLMNTYNVVEERLPKAVLIADVLA
GLAEFEVMRALFSTLDIRWLVVTVPNRRLRRPAVGGSPRSDLFSIPTDAPDEVYERQLRA
LTRTGLNPRPAAKPNPLRPTETPHSHLTRGAPTTNATRPLITTVKVQDHLTRTSRASQAD
PRTPLGRDPIILIGASTGGVDALLAVLTRFPQDCPPTLVVQHTGSGFGESLASLLDRQCL
PNVLLANGPMPLRRGQILVGAGIRAHLVLDGRAATRVTTVADGPVAGHVPSVDRLFLSAL
PVAPRVSAALLTGMGRDGADGMKALRLAGAHTLAQDEASCVVYGMPRAAVELGGVDRVLP
LKKIAEALLARRKTNVGPGREVQK
Download sequence
Identical sequences A0A0B3SIT6
WP_052244826.1.21834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]