SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_052262223.1.52665 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_052262223.1.52665
Domain Number 1 Region: 118-415
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.75e-60
Family Pancreatic carboxypeptidases 0.016
Further Details:      
 
Domain Number 2 Region: 658-739
Classification Level Classification E-value
Superfamily PKD domain 0.000000000262
Family PKD domain 0.0094
Further Details:      
 
Domain Number 3 Region: 572-648
Classification Level Classification E-value
Superfamily PKD domain 0.0000000275
Family PKD domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_052262223.1.52665
Sequence length 740
Comment hypothetical protein [Pseudoalteromonas luteoviolacea]; AA=GCF_000814765.1; RF=na; TAX=43657; STAX=43657; NAME=Pseudoalteromonas luteoviolacea; strain=HI1; AL=Scaffold; RT=Major
Sequence
MIKTLIKTSLLAAFGALTLPSYAHTQVETNITAHQPNNLNYSLYFSNEDQRVTYSRQYHG
QIVESLHNALVVSLSEKEFLLARSSGAVILEHAPAKTINRAANALVNANQSILTTTQTSG
IPNFPCYPTLEETYELAEQLAEKYPNFVELKHIGQSWKKEQGLGGHDLTVLVIKNKKRNK
HKKLPTMYMQGALHAREYTAGATTIKFAQHLLENRRNNPDIKWILNQREIHILLIANPDG
RKYAELGKEWRKNTNTAYCATNEEQIGADLNRNFDFAWNSTPYSSDEQCSNTYQGPVAAS
EPETQVIQNYINSIFEDNRGELDTDAAPLDTAGLFIDIHSFGGMVMWPWSHLRTPPPNSA
GLSMLGHRLAAYSGYVAYQVGNRFHVGGSAEGYAYGQLGVASFTYELGKEFFEHCGNFEG
EIFPNTLKSLIYAAKVAKAPYKISGGPQILDYKLEGAGDVAVPPGTPINLTAGIYDDFFG
NQSYSPLPPSQAVKKVKLVIKKQGEGVVQRLKLPAADGIYDSPREQLNYALDTSNWDDGR
YTLILKAQDVTGQWGVKYAKYLTIDDDASAQNKAPVADFTPTCTYGTCQFDASKSTDDKP
GLKYRWFIGSETSRKEYSGEKIEYVHEMAGTYYVTLVVEDANDISAVKHAVFDLDGKYLP
IANFTYQCAGLICEFDSSGASDPDGHIVERLWRFGADAMYLPGKVKETFTFPTAGQYRVA
FVVRDNDGQYNETYQFITVN
Download sequence
Identical sequences WP_052262223.1.52665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]