SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_052300972.1.3402 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_052300972.1.3402
Domain Number 1 Region: 527-614
Classification Level Classification E-value
Superfamily PKD domain 1.44e-16
Family PKD domain 0.0046
Further Details:      
 
Domain Number 2 Region: 442-527
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000000128
Family PKD domain 0.0028
Further Details:      
 
Domain Number 3 Region: 268-354
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000262
Family PKD domain 0.0031
Further Details:      
 
Domain Number 4 Region: 353-439
Classification Level Classification E-value
Superfamily PKD domain 0.000000000000798
Family PKD domain 0.0046
Further Details:      
 
Domain Number 5 Region: 625-978
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000235
Family Quinoprotein alcohol dehydrogenase-like 0.018
Further Details:      
 
Domain Number 6 Region: 103-194
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00000437
Family MOA C-terminal domain-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_052300972.1.3402
Sequence length 998
Comment hypothetical protein [Methanosaeta harundinacea]; AA=GCF_000235565.1; RF=representative genome; TAX=1110509; STAX=301375; NAME=Methanosaeta harundinacea 6Ac; strain=6Ac; AL=Complete Genome; RT=Major
Sequence
MRKILSLLLSVSIVCCYVTSCEEAAYALGESGSMKLDQYSLSELNGSEIATFTVTSRSGD
TGEKTICPGERDLASIKKEIEKRVEVGNQKVVDKAASLAQRFPGDHSVEQVCEIFEYLKN
NWNYTGDPRCGEFYRYANQTIRLGEEIGRAGAGDCDDFAILMAALIENIGGTTKINLVYD
EWQGHAYTEVCIGKHNSNDNKVNKTSTWLKKKYNVEKIYAHVDESGFVWLNLDWWADHPG
GPFYPVDNHKGFVRVNPHLPIVSLNPPNIPPNPVISWEVEEPNAREPIIFDASQSYDLYG
GIADYEWDFGDGVREKGPVVNHTYRKGGPYPVMLKVTDVEGKENRTISSIEVNEPPVAEF
SYSIEDKKSGYLITFDASESYDEEDGEVASFTWNFGDGHTTMELSDGLATNFYPRSGTFN
VSLTVKDSNRALGVKSIPIKINLPPIAKFSVNNSEPNVGEGIAVDASQSLDADGKITEYR
WNFGDGKTARGPQAIHNYLKGGNFIIKLEIIDDNDAVNSTTRDLRVNKPPVAAFSYAPTS
PRADGIVTFDADESEDLDGRIVDYLWDFGEGGRKQGFACVDYKYIKGGVYSVVLTVTDDD
GAKSSNSKKVTVGEKESSTAEDHRPERGVLAESDKKGLEGWSRTFGGAGQDGGYSVEQTA
DGGYIIAGRTLDAFGGDDLWLIKTNSAGYRAWDTSFGWEGADWGNSVQQTADGGYIITGY
TQDDLGGKDVWLIKTDSAGNRVWDRTFGGSGQDEGNSVQQTADGGYIIAGYTLDNFGGDD
LWLIKTDPDGDLVWERTFGGKGHEQGDSVWQTDDGGYVITGRTLDNFGGDDLWLIKTDLA
GDLVWERTFGGEGADWGHSVQQTADEGYIITGYTLDDFGGKDLYLIKTDSFGYSEWERAF
GGAGQEEGHSVQQTVDGGYIITGYTLDDFGGDDLWLIKTDSSGYRVWDRTFGGAGQEVGF
SVQQTTDEGYIITGYTLDNFGGDDLWLIKTDKNGNLVG
Download sequence
Identical sequences WP_052300972.1.3402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]