SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_052368101.1.30995 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_052368101.1.30995
Domain Number 1 Region: 1544-1817
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 6.21e-63
Family Quinoprotein alcohol dehydrogenase-like 0.0012
Further Details:      
 
Domain Number 2 Region: 1067-1228
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 7.06e-34
Family Quinoprotein alcohol dehydrogenase-like 0.00062
Further Details:      
 
Domain Number 3 Region: 951-1072
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.45e-28
Family Quinoprotein alcohol dehydrogenase-like 0.0011
Further Details:      
 
Domain Number 4 Region: 877-996
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.3e-25
Family Quinoprotein alcohol dehydrogenase-like 0.0014
Further Details:      
 
Domain Number 5 Region: 1241-1326
Classification Level Classification E-value
Superfamily PKD domain 6.41e-18
Family PKD domain 0.0024
Further Details:      
 
Domain Number 6 Region: 1326-1406
Classification Level Classification E-value
Superfamily PKD domain 0.000000000000144
Family PKD domain 0.0028
Further Details:      
 
Domain Number 7 Region: 787-869
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000144
Family PKD domain 0.0051
Further Details:      
 
Domain Number 8 Region: 1842-1933
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000262
Family PKD domain 0.0041
Further Details:      
 
Domain Number 9 Region: 1412-1489
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000275
Family PKD domain 0.0032
Further Details:      
 
Domain Number 10 Region: 1945-2023
Classification Level Classification E-value
Superfamily PKD domain 0.00000000249
Family PKD domain 0.0038
Further Details:      
 
Domain Number 11 Region: 513-601
Classification Level Classification E-value
Superfamily PKD domain 0.00000000353
Family PKD domain 0.0087
Further Details:      
 
Domain Number 12 Region: 2036-2149
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.00000000778
Family Cellulose-binding domain family III 0.017
Further Details:      
 
Domain Number 13 Region: 1475-1544
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000369
Family Quinoprotein alcohol dehydrogenase-like 0.0035
Further Details:      
 
Domain Number 14 Region: 2172-2225
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000432
Family Type I dockerin domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_052368101.1.30995
Sequence length 2234
Comment hypothetical protein [Haloferax sp. ATB1]; AA=GCF_000730175.1; RF=na; TAX=1508454; STAX=1508454; NAME=Haloferax sp. ATB1; strain=ATB1; AL=Contig; RT=Major
Sequence
MYPVVVTIDIGSGSFLSSNHVEDPTLDLTVEGDATIESIQPTEYDTITDESETTASLSAT
DFFRTATSQTAVVLVEVPESADGGSVSVTAEPGDGGGAVSSTTATYNVTSQASTWDAMNG
SANARATLASSYQASYDRLLYSEPWNETVQTSMRDGFSTVITEETKGAVLGSVPGVGTAL
QARDAYQVATGNYDGGTAGQIAAVNQKLKNDLDARMTRDDVRRAGNSSALLAELERLYEQ
EQVAWEEQDRERLREVILRQRAVLVDACLSRVSSNPYAGSYDTCLAVESDEQRTASLSST
EFGDSNGAMAQYFGSLERFSYEEYERADRRLDLIKEPNPSVRLTEDPATIEERLGELKVD
ETTTVTFVVSNARGAGVSGERSYLSLSHGENISVADVTPLTDAGANVSVQRTSPGSEAVN
ASGETITLDHHLIDIRSQYKPGDERTFRVTVEKTDNGTGWLSYRAAFQPFLVEEGLSNAE
AQAAYARMPTSGPTDQQDWPVRTLSTNGSVEPPLPVIDVSSNVLTGEPVELNASGTTADD
SIESYEWAIDTDGDGTTETTTTGVTSSVTFDAAGTAQVELTVRDAAGRTATSSTAVDVAN
ATVAARTTDIGVAVDRTYPEPGDSLTFDAPADVSDPSWSVIRGDTAVDAGSGGTFATTLD
EAGVYEVTLSGVIDGRSVSVTRVVDVATREERVAEPSVSVSAPSSADPDEPITIDAAEST
HPHPDREISEFELLVDGSLVATASDGMFEYALTTSGEHELGVRATGSAGNVTTVRRTVTV
NTRSDSPTPVIDISPTAPVAGETLTLDASGSTAATAIQSYEWAFSNGETATGETVTREFE
AGEYTVELQVTDSEGRTATTDATISVGDPQFSQSPTAVYVGLTSGSVLAVDAATGEERWS
VETDDAVVSSPTVANGTVYVGSRASISFDDSLYALDAETGSTQWTFSTDNDGVVSSPTIV
NGTVYVGSQSLWGPGLHALDAATGAERWARDIGPIDGSPTVADDVLYAETGDQSVAAVNA
TTGETHWATDVGSPVSSSPTLAGETVYVGTIDNTLTAIDAETGAIRWSFETSLRGDVESS
PTVVDGTVYVGTNNNSLYAVDAATGQAEWNVETGGAVSSSPTVANGTVYVGSEGDSLYAV
DAATGDLTWTYTADGPVTASPTVSNGTVYIGSEAGTLYAIDASAGDSTWAIETGSAIRSS
PTAVADVEAGDSVGSRVGLGTLGHTDRWADKHHVDIDPDEPIPAFIPNRTDLIAGDTVQF
DASNSRSVVGIATYNWSFGDGSTNAAGSAWTEHTYDSAGNYTVTLTVVDENGQSNRTERT
LTVAKPLSAALTASRTEDIDTPVEFDASNSTGEISTYAWDLTGDGRTDATGEHVEYAYDT
PGEYDVSLTVTNNDGQQRTTTETLLIGDPLEATLTVPSRSVDVGDSVRFEANDSIGSIEE
YRWSVDGQSKQGETITHVFDRGGTYTVELIVVDDDGHTATTTATITVDGVPAGQAAWTYA
ASDAVTSSPTVVNGTVFVGSHDRSVYALDADSGDKKWEYMTEVDVYSSPSVVNGTVAVAS
GGDVYALDAESGEKQWEFETISTIHSSPTIAGETVFVGNRNGNVYALNVTTGAVRWTFET
DGRVDSSPVITDGTVFIGSNDNHVYALDATSGDQQWAFETGAAVESSPTVANGTVYVGSN
DDNVYALDAESGAQQWAFETGWEVESSPTVANGSLFVGSKDGNVYALDADSGTEVWTYET
GDYQVVSSPTVVDGTVFVGSSDDSEPSSMFALNAESGEVRWTYPTNIRTPVESSPTVVDG
RLFFGDNDGDVYALGTDVNGSSAGSRVTLGALGHHHAWANRTIELQPPASELTLTVNRSE
PSVGQAVRFDATNTTEGIDQYAWDVDADGTNESTTTNGTVVYTYGEPGTYTATVTAVGTA
GNDTASVELTVTSGETADFDAAVDAPSTVTVGKNITFDASNTTGDILEYTWDTNGDGVAE
AETRGATYTSVYESPGTYTVTVTAVAETAAGDTVTDTATTTVVAEDADADSELSRFVVGD
RAVDPGETVAVPVTVENASGVESYSANLTFDPAVATIEDVQLTGTDTAVTINNETGTVSI
GAALDDGEDPQATLVFELTAAATSPVKIRSATVWTDDGEHTPETQNGTVTGGPLPPIGDR
QRAPTDPDADGLYEDVNGDGTVTVSDVQALFVDRNDATIENNTHQFDFSGNGMFNIVDIQ
RLFNATKQEASPRE
Download sequence
Identical sequences WP_052368101.1.30995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]