SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_052373874.1.12874 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_052373874.1.12874
Domain Number 1 Region: 649-828
Classification Level Classification E-value
Superfamily GAF domain-like 9.81e-26
Family GAF domain 0.0067
Further Details:      
 
Domain Number 2 Region: 877-973
Classification Level Classification E-value
Superfamily SpoIIaa-like 9.42e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0065
Further Details:      
 
Weak hits

Sequence:  WP_052373874.1.12874
Domain Number - Region: 71-171,256-290
Classification Level Classification E-value
Superfamily TPR-like 0.00275
Family Tetratricopeptide repeat (TPR) 0.051
Further Details:      
 
Domain Number - Region: 524-606
Classification Level Classification E-value
Superfamily TPR-like 0.00948
Family Transcription factor MalT domain III 0.056
Further Details:      
 
Domain Number - Region: 241-342
Classification Level Classification E-value
Superfamily TPR-like 0.019
Family Tetratricopeptide repeat (TPR) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_052373874.1.12874
Sequence length 1005
Comment hypothetical protein [Chondromyces apiculatus]; AA=GCF_000601485.1; RF=representative genome; TAX=1192034; STAX=51; NAME=Chondromyces apiculatus DSM 436; strain=DSM 436; AL=Contig; RT=Major
Sequence
MVEDGHKQEVHLTIGRLLRGESGGSSRDEALFTITEHLNRGAMLITDRAERRALAEMNLT
VGRRAKAAIAYQTAADYLRAGIALLGDALDASWADDYALCYGLHAELCECAFLTGDLAEA
EALFGTAIARAHAPADQAHLHDMRMVLYTTAGKYRETLDAGWTALALFGLEAPTGAGGRA
ARMEAELARAQATLAERTPEALLDAPGLVDPERRLEMKILIDMSLAGYFVDPVQFALAVA
RAVNISLEHGHMDLSAYAYMLYGLVLQASGKLREAHRFGELGLALCARWNSPRVEAKVLC
SAASTLMTLFEPLRASLPRAARGMKLALESGDTLSFSYCAYMKLFNKAAAGEELRALRAG
LTEVRARLVSLKNAPGIEVVELGMQFAACLMGETRARTSLGDATFDEDALEARLEQADAS
FNAGWYYTLKVQLAVLYGDPRGALASAVRAEPFCTALAGCFFLTDLIFYASLARATLGAD
GADGADGADGAGGADAEALAQGRAQLAAWTESCPESFLHKKLLVDAALARASGDPIAAMG
LLDQAIEAARRHGFVHHQAFASEMLAELHLAEGRPHAASLHLSEAHGAYLRWGATAKAEH
LAETYAEIFVPWPGMQRPGGSAEASPALPSSTVTTTTGDTKSSALDMVALLRAAQAIASE
IVLEKVLDRIMRLVVENAGAQRGFLFLPREGKLMTSTSMTVQPDTVTVGPPVPLEETRDV
AHTVVHYVERTRDPVVLADAHRDTRFAGDPYILARRPRSLLCLALTHQGKLTGVLYLEHN
DAADAFTPARLEICHVLCSQAAIAVENALLVARVQASTTALQRLNGELEAQIALRTEELR
ETNDHLTRELGERARAEIERARLQEEVIQVQHERLSEMSTPLIPITDRIMVMPLIGTMDA
ARVNQVLETALEGAQSRAASVVIIDITGVRRVDSHVASSLIKTAAALRLLGAQVVLTGMR
PEVAHTIVSLNIDLKGIVTVGTLQSGILHALRHSGEAGRIRSALA
Download sequence
Identical sequences A0A017TJE2
WP_052373874.1.12874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]