SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_052496321.1.24884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_052496321.1.24884
Domain Number 1 Region: 531-971
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.41e-40
Family alpha-mannosidase, C-terminal domain 0.017
Further Details:      
 
Domain Number 2 Region: 119-306
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000000133
Family alpha-mannosidase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_052496321.1.24884
Sequence length 991
Comment glycoside hydrolase [Pedobacter lusitanus]; AA=GCF_000832545.1; RF=na; TAX=1503925; STAX=1503925; NAME=Pedobacter lusitanus; strain=NL19; AL=Contig; RT=Major
Sequence
MKPVSYRLQFNALLITFLIGISHNVSAQKTGSAFSDIQLQPTIAYLKYHGESRRMIRLIF
KNGKNYQQGKISVSFNGLQESLIVQASKDGAESFEIPLPGSPVTKATQATVSILTGGKTY
KGSCIVEPSRMWNMYVLPHSHVDIGYTNTQSKVLKLHQDNIDEAIALAEKTQQYPTQARF
KWTTEAIWVVDNYLALASQQKKDKFWDAVKKGWINLDGAYGNINTSLTDSRQLMQMFSKS
QKLAKEQGIVINTLFQGDVPGASWGLAAQVEQTGIKYFLSGPNASDRIGNLAKWQDKPFY
WLSPSGKQKLLFWQCQPYSIGYQLKGDKIPNFFTMEDPKPFYTGHPSKNFLNPYLFDYLD
QLAQKGFPYDMSILTWAMSDNAPIDPELPDAVKIWNEKYASPQLIITSTKQFFADFENKY
NRQIPSFTGDYTEYWTDGVSSAAKETALSRKLSDQLKQADAIWAIRNRKNYPVKSFEESW
KNLLLFNEHTWGAFNSVSHPDDEKVKSEWAVKQSYVLKAKEIVDTLLSQSLTGDSLKDSS
STLKNNQIDVYNTVSWPRTNVVYVPASLSKAGDLVKDVSGIPVLSQRLTTGELAFVAELV
PSMGKSTYSIYPGHAYHPGTTRTKSPGSGKASEKKSGVNISDNLLSNGVYSIDISPQTGN
IKKLVKIASGRDYVQADSAGLNQYLYMPGDSLEKIQTSSNARIAIKEKGPLVISLQITSS
APGTNGLIREIRLVNGLDQIELINTIDKKAIRSKESVHFAFPFNIPDAKVRYSIPWGTVN
AETDQLPYSNRNWYTMQRWADISNDTYGITWSSPDAPLFEIGKITTANLLGGLQHAPLWL
SFTPQSSNIYSWVMNNLWHTNFRADQQGVVTFRYFIQAHESGFNSYQANQSGLNNHQPLL
VTAASADEKGLPFTINGENIYVEAFKKADDGKGIIIHLVNCGDQDSKLNISPKTNAPLKI
WESDISETHKKTLENHFTLPAKGIMTICIEN
Download sequence
Identical sequences WP_052496321.1.24884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]