SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_052516403.1.38272 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_052516403.1.38272
Domain Number 1 Region: 689-973
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 7.38e-27
Family alpha-mannosidase, C-terminal domain 0.024
Further Details:      
 
Domain Number 2 Region: 291-475
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.17e-21
Family 4-alpha-glucanotransferase, N-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_052516403.1.38272
Sequence length 1155
Comment hypothetical protein [Phaeodactylibacter xiamenensis]; AA=GCF_000759025.1; RF=representative genome; TAX=1524460; STAX=1524460; NAME=Phaeodactylibacter xiamenensis; strain=KD52; AL=Contig; RT=Major
Sequence
MEKHQRSNILHLDERTAKRIGMKWKVFFSVLFCVALWQGLAAQRSHFAGFGKALGGQAFA
YHSPFSYNEKSLLVRARADSEPISWVTEVVPASYAEKSATFIWAYGIGAKQPSQSFDLYV
EGQKVLTFTTPDGKEVTRAFTGENGVALTFNRSMIDLNKDEMGTATLLLPASYFTPGKAV
RLKVDGVDNESYEWFMVFQRALQEEVKAFQLNTVTKQDGLHFHTVRLEFIHLGGPSEVRV
AAKGVKAQHFAVNTGFNEVDFLVPVAEKAGELAMDITIGETQSPLKVEVGPVKKWVVDLV
QHSHTDIGYTRSQTEILAEHLRFIDYALDYCDQTDDYPDDAKFRWTCEAAWTVREYLKSR
PQEQIDRLLARIKEGRIEVTGMFFNFSEIIDETALAIQLQTLKAFKAKGIDVTAAMQNDV
NGIGWAMIDLFEGTGVKYLTMGQHGHRARIPFDKPTSFWWESEAGNRLLAYRSEHYMHGN
ALSLTSGAIDQFRANLSGYLKKLEEKGYPYDRTAFQFSGYLTDNSPPSTMACDIVKEWND
KYEWPKLRLSLASAFMVYLEENESGTLPVKKTAWPDWWTDGFGSAFNETKAARRAHADMI
ANTGLLSMARLMGTPMPKDMDRDMLRAFDELFFYDEHTFGAAESITDPLSENSIVQWGQK
SAYAWTAFKEARLIQEKALGLMQQHIPKAGVPTIAVFNTLNWARAGLVEVYIDHELLPPN
RAFTILDPEGRVVPAGLVSSRADGSTWNLWVQKVPPLGYTTLRIIVQEQGVVPVGRPEAA
SGNTLENDYYRLTVDAGQGGIVSLFDKQLGKELIDQTADVPLGAFLYERLANRADMERLT
NNNRDTVYVPLKKEISRLSEVEIAKVETTPLWKRMVIHGEIPECADARGVTLEIRLYHSA
KKIELAYSMVKLPVTEPEAVYVAFPFGMSEADQLAFDVQGGIVYPGINQLEGTASDWNTV
QTFAAVQNKEAQVLWSSVDAPLVQVGAINTGRFYYKHEPELPHLYSWVLNNYWTTNFRAS
QEGEMKWQYCLTSVPDTSKAAATRFGWGNKVPMLGRVVPPAFNKTGSPPVMQSLLDLELP
NLLLVSARPLPDRNAVLLHLRETDGLPAVLDLTRILSQTGMGGAFEANVLGETTKEAIST
CRMAPYETQFILLVP
Download sequence
Identical sequences WP_052516403.1.38272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]