SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_052670624.1.67185 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_052670624.1.67185
Domain Number 1 Region: 732-1189
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.34e-42
Family alpha-mannosidase, C-terminal domain 0.023
Further Details:      
 
Domain Number 2 Region: 332-530
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 7.56e-26
Family alpha-mannosidase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_052670624.1.67185
Sequence length 1191
Comment hypothetical protein [Draconibacterium sediminis]; AA=GCF_000949475.1; RF=na; TAX=1544798; STAX=1544798; NAME=Draconibacterium sediminis; strain=JN14CK-3; AL=Contig; RT=Major
Sequence
MKQKNMKTTACSKWKRVIYSIIGLIILVPGYIRAHESAGKSKIHSVNVNYELYQISKDDI
EGFSEQLGGGMYSYPSLRDDVRDAMIARASTGEAGFEFLTEMVPANYPNEVVNFFFYSDI
DLNIREPYDILVNGKALLTLKANENGGLEILQNPGKGNATYYLYRRDGNGDGIGAFRLTV
PTAMLKKGEKAQVSVYGQHMGTNGWFMLFKLQNAISWLKGAGLNDVSFSIKQFNDKLLID
APVHLVGEKVSVVADGNKSNEAVFKKQGEMAKASVVAEAPKKSLTINYGDKTYDVKFKKG
NGEINENVAAGEFYYNSNAHFHNSWVADFTKRYRPDFYAAYEPFFENKYEKGLISIMNSS
HQDIAWVDRPEACIIMRDTLLLSPIIKDAFVRKDYGFDIEDGLMLREYLERHPDAQEKLT
TLLNRKLLSVGATYNCPYEDMYDAEDLVRQLYLGKLWVKKYFGGYDSKVYWNVDVPGKTM
QFPQILKKAGVDYMIISRHAKSMTHWGSPDGSTVFTYSPGHYGEDLIHLSKDIDEKVKYG
AEQVVWWSRYFKDSETQTPLLSSQDMLPAIDYSNFIETWNATEEVYNEKGENIDVHFPNM
ELMTVDEYMPLAEQHAISVDTIWGERPNVWVYIHGPGHHDALTASRKASKLLPAAEKFLT
VADVLDEERMPYPYEELDKGWQAKIFPDHGWGGHDGDITDNLFKEHLVKSQVIGEKLLDD
ATTFIAQRVKTSEKKGIPVVLFNSLSWERTDPVTVELDFPKGKAKGLKVITNDNKEVPFQ
LAKVIKYDDGSFNRANIVFVAENIPSVGYKTYYVQTKTKRNTIADDVAFNPVYENDFYKV
TFAEGGVEQIYDKELSRNLFTTKAFKVGEIFTLQSEGNGAGEFGDVQQPFMKDFDQVSVH
GAKWELEQTGDVYTTYKLQQEIKHARVEQRVTIYHQLKRIQFNNKLINWDGTLYREFRTA
YPVAIKNSTIKHEVPFGTVEVGKNEITTAGERYTVLCKDVHPRAIMDWISANNEDVCVTV
SSSVAAADWINPTQTTDADFLQHVLLASRTSCHWEGNEYSQAGSHDYSHVLTSTKEGDIA
GSRIAKQFNEPIKVVVNPEQSVKANLEESISFFNIDKENVIVSAIKKAEDGKGLVMRLYD
AEGKAAAPHLNSYFKLNNLRHTNLIEENPKQVNQIKVSPYSIETYILNSKQ
Download sequence
Identical sequences WP_052670624.1.67185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]