SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_052703303.1.86303 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_052703303.1.86303
Domain Number 1 Region: 124-317
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 3.95e-20
Family alpha-mannosidase 0.056
Further Details:      
 
Domain Number 2 Region: 563-1031
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 6.59e-16
Family alpha-mannosidase, C-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_052703303.1.86303
Sequence length 1037
Comment hypothetical protein [Microbacterium sp. SA39]; AA=GCF_000967865.1; RF=na; TAX=1263625; STAX=1263625; NAME=Microbacterium sp. SA39; strain=SA39; AL=Contig; RT=Major
Sequence
MKPSLISASPWTGEEARAGLIDRATAAVGRIGGHTVRVIPEPLQRQVDGQNARSVRVAVD
GPREADAGALDVVLVDAQGATVNVGRADAPAGSVRVLVPASDTPTTVRVRIPELGDEVVE
AELDVVRPWSVHVVHHSHFDFGYTDPQAAVIANQRSYLDSAVDLIHQTADWPEASRFRWN
AEALWAFGDWESTRTRGEVDELVKLVKEGSIGLSAMPYNLHTDTCSTDELHELLASARRI
RDEYGIDFASAMQTDVPGQVAGLPDALSDLGVRYLAVAHNWAGRSEPHRNGALDMPRMFR
WKSPAGKSVLVWMTDSPHGLAYIEGPMVGFTESFETLETLFPAYLTALSTRGYPFPPGVF
GAHGEEDPGRQPYPWDVLHVRTQGFMGDNGPARLHLSEQVRQWNETWDFPKLRVSRNEDF
FAEAEERVGDELQTFEGDWGDWWVEGVGSGAVPLALAREAQVSAPVARSVSQLSRWSGGE
AVTSEGVDAQAAYDAISMFNEHTWGASNSWTHGDEGYDSGERQWQWKVGHAIAAHQRTAD
ATERALHHLAQAVAPAESALAGYVVVNVAGHSRSSVARVLVKESQVPLEADFRVIDTRTG
NTVPHAIEAQGNSLHRESGRWITFPVAGAPEVGWVRFDIVAADAPAEPARRHPLQSAPRE
QLLVLENEHLRVEVDDRRSVIRSLVEKSTGRDWVNTESVAGFNGYIYDTYGSSGAGVNHL
ANKLSVSPRLELLASRTEARPSIVIERVDDAVEQRLVYEYAADGVDSVQVTLRLRHGDPT
LLIENRVSKPVTRVKESGYFAFPFAADEPSVRFEVSGGVTGDGIAHIPGAPQHMRAIRNW
VSVVDAADAVAWATKDAPLVQTGSIALPYSPFPASTSPHEPGTVFSWFHNNVWDTNFPIE
QGFTATFSYAVGVRANAEESAEALAVRTASAVARPLLSIPAAGRGTPVSEASFVRMDDDR
VALIGIGATDEEGWTRLRLQSFADEAVPLRIQVEGADAARRTTLLGDVLGDVAVDGAAIR
LDLAPFETAGVEVRVTH
Download sequence
Identical sequences A0A0F2CE76
WP_052703303.1.86303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]