SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_052713325.1.7195 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_052713325.1.7195
Domain Number 1 Region: 121-440
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.36e-56
Family Pancreatic carboxypeptidases 0.012
Further Details:      
 
Domain Number 2 Region: 662-744
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000576
Family PKD domain 0.01
Further Details:      
 
Domain Number 3 Region: 576-654
Classification Level Classification E-value
Superfamily PKD domain 0.000000523
Family PKD domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_052713325.1.7195
Sequence length 746
Comment hypothetical protein [Pseudoalteromonas rubra]; AA=GCF_000967655.1; RF=na; TAX=43658; STAX=43658; NAME=Pseudoalteromonas rubra; strain=S2471; AL=Contig; RT=Major
Sequence
MKKNVMGLALFGAISLSANAHSGHKETSTPSLAMTEHTLSTYQLAFSSDAQKVQYLTRYH
DAVLDVKDNYLVLTLNQAQFVELQGNGALIFSRADTTGRADGAPITNSPMTARSQSAGQT
SGIPSFPCYPTLAETQQMAETLAQTYPDFVELKHIGPSWEKSQGLGGHDLNVLVLKNKKK
NKWRKRPALYMQGALHAREYTPGATTLKFAQYLLENRETNADINWIMDQREIHILLIANP
DGRVLAEQGLSWRKNTNTAYCALDDTLRGVDLNRNFDFAWASPIGGSTDEQCALRYHGPS
AASEPETQAIQAYLKGLFKDRRGDLLSDPAPLNTQGVFLDLHSFSRFVMWPWSSELTPSP
NGEQLSMMGHRMAAYNDYLAFQTQEIFKVGGSADGYAYGQLGVASFTFELGNAFFESCAN
FEGEIFPNNLNALIYAAKVAKRPYKMPAGPQIDDLRLQGAGNEAIPAGTPVQIIATVADD
IFGRSLTGQLPPSEAIRKVELTIKRKGKRGKRRILLPAADGVFDTARESINYTLDTHRWR
QGRYTLTFRAQDASGQWGPKHAKFLTIDNGAMPGTVAPVADFVADCRKGICGFNGSVTQD
DRDALAYRWVLANDDFYAVFHGEQVEIDYYYAGNYQLTLQVDDSHGYRDTKTVQLALDGI
RPPVAQFDYQCNGLTCEFDSSASTDPDGEIVQRLWRMGAQSTYLPGAEKAVHTFSAPGEY
GVALVVIDNDNEFNEVWQTITVTENK
Download sequence
Identical sequences WP_052713325.1.7195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]