SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_052721725.1.43275 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_052721725.1.43275
Domain Number 1 Region: 526-849,909-925
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.62e-36
Family Quinoprotein alcohol dehydrogenase-like 0.0031
Further Details:      
 
Domain Number 2 Region: 12-335
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.5e-33
Family Galacturonase 0.094
Further Details:      
 
Domain Number 3 Region: 923-1015
Classification Level Classification E-value
Superfamily PKD domain 1.96e-30
Family PKD domain 0.00021
Further Details:      
 
Domain Number 4 Region: 1019-1102
Classification Level Classification E-value
Superfamily PKD domain 9.03e-30
Family PKD domain 0.00029
Further Details:      
 
Domain Number 5 Region: 344-429
Classification Level Classification E-value
Superfamily PKD domain 3.53e-27
Family PKD domain 0.00026
Further Details:      
 
Domain Number 6 Region: 434-517
Classification Level Classification E-value
Superfamily PKD domain 1.7e-26
Family PKD domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_052721725.1.43275
Sequence length 1315
Comment hypothetical protein [Methanosarcina siciliae]; AA=GCF_000970085.1; RF=representative genome; TAX=1434120; STAX=38027; NAME=Methanosarcina siciliae T4/M; strain=T4/M; AL=Complete Genome; RT=Major
Sequence
MGKIYYFCIVALLSAMIAMPVSATTYYVDDDGGADFTSISDALNAASSGDTIYVYNGTYV
ISGSGSVMTNTYVTLTGEGADVVSWDLLDTEGLIIGSNNAGEEADGCIVEGIKFVNSACG
IRLGTYGPAPDSIIRNCVFEGLTASNGVEIESDNVTFENNIIANATGGGSGLRAQTVNNC
KLLNNTFINSPGTYGSLYLQGAYGQIIGNTFINNDATAVMLVFPESCIVRGNDFTSNGDG
VSIGIYEGDNNSIYLNNIGAGSASMPFGGSIPTNTYFNSTEPIEYNYNGATYSGYLGNFW
SSAYTGSDADGNGIGNTPYTIPDGLGTDHAPLMAGYENYLHPNEPQNTPVANFSAVPFSG
NAPLAVQFTDLSTGSPTAWAWDFDNDGNVDSTEQNPSYTYNDAGSYTVNLTVTNADGSDS
EVKDAYIVVSGPLPEAPVANFTATPTAGNAPLTVNFTDASTGTVSSYAWDFENDGTVDST
EQNPVHTYVAEGNYTVSLTVTSTGGSNSEVKPDYITVSKSYIPAEPGEDWPSFQKDLHNT
GLTSDRGPITAPDEEVSWDVYTHGTGMAGIDTVPVVVNGSVYVISTDGHVRAINRTTSAL
NWETPIPDCSGFQLGNPAYGNGKIFVPTADSRIFAFDAWTGTELWNDSVESNKPSSSSLY
HQLNTPVVYDNGRIYFGQWIPSNYAGKYYCYTEDGTEVWNRDCTHGNKGYYWAGATVVGD
YLVFGGDDGYLTSLYKVNGTLVDEINIGAGEIRSTLVYDEESNRIFTSTKNGYCISIEMS
PEGTFNNSSKVQSASFGAQSTSTPVIYNGRVYLGSGNFQASSPFFCLNSTDLSVIWSFTG
TTGGVQSSPVVSTAYDDGDGEVYIYFTTNAKYGRLYCLRDNATNTNMTSEEWYFQPEDSK
NQYTLQGVALVGGWLYYGNDKGYLFGLAGVQNESEIPVADFNAAPLSGNSPLTVNFTDDS
TGSPTSWSWDFGDGTNSTEQNPSHTYNSTGNYTVSLTVSNDGGSDSEVKIDYITVSSTPV
EPELVAAFTADVTEGTDPLTVNFTDQSTGSPTAWEWDFGDGANSTEQNPSHTYVSSGNYT
VNLTVENAAGTDFELKSDYIEVSKASGSTVTLYFDPESSSVSENESTEINLVASLFPAGF
SGYNLTVALDNPAVAEIVDIEYPSWALITENSTLPGTSIYLKAVDGNNTVKEGAADVVLA
TLTISGKESGSANLSIGVDRLDDDSGETIEPEFLAGKIEVTLLSPLPDQEYAPKDLDGDG
LYEDLTGNGEFSFVDIVAYFHNMDWIEENMPVEYFDFNGNGRIDFDDVVRMFGMI
Download sequence
Identical sequences A0A0E3P8M9
WP_052721725.1.43275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]