SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_052727399.1.11460 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_052727399.1.11460
Domain Number 1 Region: 526-849,909-925
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.58e-36
Family Quinoprotein alcohol dehydrogenase-like 0.003
Further Details:      
 
Domain Number 2 Region: 12-335
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.47e-33
Family Pectate transeliminase 0.076
Further Details:      
 
Domain Number 3 Region: 1019-1102
Classification Level Classification E-value
Superfamily PKD domain 1.31e-30
Family PKD domain 0.00028
Further Details:      
 
Domain Number 4 Region: 923-1015
Classification Level Classification E-value
Superfamily PKD domain 1.96e-30
Family PKD domain 0.00021
Further Details:      
 
Domain Number 5 Region: 344-429
Classification Level Classification E-value
Superfamily PKD domain 2.62e-27
Family PKD domain 0.00026
Further Details:      
 
Domain Number 6 Region: 433-517
Classification Level Classification E-value
Superfamily PKD domain 6.8e-27
Family PKD domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_052727399.1.11460
Sequence length 1315
Comment hypothetical protein [Methanosarcina siciliae]; AA=GCF_000970145.1; RF=na; TAX=1434118; STAX=38027; NAME=Methanosarcina siciliae C2J; strain=C2J; AL=Complete Genome; RT=Major
Sequence
MGKIYYFCIVALLSAMIAMPVSATTYYVDDDGSADFISISDALNAASSGDTIYVYNGTYV
ISGSGSAMTNTYVTLTGEGADVVSWDLLDTEGLIIGSNNAGEEADGCIVEGIKFVNSACG
IRLGTYGPAPDSIIRNCVFEGLTASNGVEIESDNVTFENNIIANATGGGSGLRAQTVNNC
KLLNNTFINSPGTYGSLYLQGAYGQIIGNTFINNDATAVMLVFPESCIVRGNDFTSNGDG
VSIGIYEGDNNSIYLNNIGAGSASMPFGGSIPTNTYFNSTEPIEYNYNGATYSGYLGNFW
SSAYTGSDADGNGIGNTPYTIPDGLGTDHAPLMAGYENYLHPNEPQNTPVANFSAVPFSG
NAPLAVQFTDLSTGSPTAWAWDFDNDGNVDSTEQNPSYTYNDAGSYTVNLTVTNADGSDS
EVKDAYIVVSEPLPEAPVANFTATPTAGNAPLTVNFTDASTGTVSSYAWDFENDGTVDST
EQNPVHTYVAEGNYTVSLTVTSAGGSNSEVKPDYITVSKSYIPAEPGEDWPSFQKDLHNT
GLTSARGPITAPDEEVSWDVYTHGTGMAGIDTVPVVVNGSVYVISTDGHVRAINRTTSAL
NWETPIPDCSGFQLGNPAYGNGKIFVPTADSRIFAFDAWTGTELWNDSVESNKPSSSSLY
HQLNTPVVYDNGRIYFGQWIPSNYAGKYYCYTEDGTEVWNRDCTHGNKGYYWAGATVVGD
YMVFGGDDGYLTSLYKVNGTLVDEINIGAGEIRSTLVYDEESNRIFTSTKNGYCISIEMS
PEGTFNNSSKVQSASFGAQSTSTPVIYNGRVYLGSGNFQASSPFFCLNSTDLSVIWSFTG
TTGGVQSSPVVSTAYDDGDGEVYIYFTTNAKYGRLYCLRDNATNTNMTSEEWYFQPEDSK
NQYTLQGVALVGGWLYYGNDKGYLFGLAGVQNESEIPVADFNAAPLSGNSPLTVNFTDDS
TGSPTSWSWDFGDGTNSTEQNPSHTYNSTGNYTVSLTVSNDGGSDSEVKIDYITVSSTPV
EPELVAAFTADVTEGTAPLTVNFTDQSTGSPTAWEWDFGDGTNSTEQNPSHTYVSSGNYT
VNLTVENAAGTDFELKSDYIEVSKASGSTVTLYFDPESSSVSENESTEINLVASLFPAGF
SGYNLTVALDNPAVAEIVDIEYPSWALITENSTLPGTSIYLKAVDGNNTVKEGAADVVLA
TLTISGKESGSANLSIGIDRLDDDSGETIEPEFLAGKIEVTLLSPLPDQEYAPKDLDGDG
LYEDLTGNGEFSFVDIVAYFHNMDWIEENMPVEYFDFNGNGRIDFDDVVQMFAMI
Download sequence
Identical sequences A0A0E3PRB1
WP_052727399.1.11460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]