SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_053622250.1.35747 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_053622250.1.35747
Domain Number 1 Region: 31-214
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.7e-51
Family Methylesterase CheB, C-terminal domain 0.00033
Further Details:      
 
Domain Number 2 Region: 294-486
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 7.59e-48
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00026
Further Details:      
 
Domain Number 3 Region: 229-296
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.000000000000602
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0044
Further Details:      
 
Domain Number 4 Region: 831-957
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000163
Family BphP N-terminal domain-like 0.029
Further Details:      
 
Domain Number 5 Region: 711-832
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000251
Family BphP N-terminal domain-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_053622250.1.35747
Sequence length 1158
Comment chemotaxis protein [Asanoa ferruginea]; AA=GCF_001280145.1; RF=na; TAX=53367; STAX=53367; NAME=Asanoa ferruginea; strain=NRRL B-16430; AL=Contig; RT=Major
Sequence
MHQDFLNAPGGEASEVLDGAGTVTAPPFAGPVVGIGASAGGLEALREMLARARPPTGMAF
VIVQHLDPNHESMLAQLLDRQTELEVLQCEGGERIAGDKVYIIPPGRGLVIQNGVLELTH
FVQPRGLRRPIDDFFLSLAVDQQANAACVILSGTGADGTTGLRAIKEHGGVCVVQQPDTA
RYDGMPLSAVGTSLVDFVRPPGEIVDCLTSFFRRRGTDGVDDEARLVADHIDDLCRVIRA
AVGHDFSGYKRTTLVRRVERRMHVLGLESGRAYLGRVRADKTECEALFRDLLINVTRFFR
DAEMFELLRERVVEPLLRTRDPEEDIRVWIPGCSSGEEAYSIAMLFADAARRLGVPLAVQ
IFATDIDERMLQIAREATYPAAALADIPAHLRERYVVLHAERFTVAAEIRDLIRFSSHSL
VKDPPFSRVDLLSCRNLLIYFDERLQQSVVPLFHYAVRPGGYLFLGPSESVSRFEHLFPV
IDQHARLFERPPGAPQYPIDLPGSARRGEVRRGGREERRGEPSIADETVAVRRVMERYAP
PSMVLNEDGGIIAAYGRLSRYFDFPVTRTGGTSAITLARPGLRDVIGPLLRQTRDARKRV
VVRDVEIRSEYGVQPVELICDPLPDGSMLLVVRDTGAFRAADDLDLIEMDAGGDHVEALE
EELLRTRYKLRSAVEELETTNEELKSSNEEMMSMNEELQSTNEELSTVNDELKIKVEQLT
IANADLRNFFESTDLAVVVLDRELKVRSFTTAATTIFPLQPGDRGRPLADVSSRLAGHEY
LHDAREVCAGGSVIQRRVATRDGERTLSLRVLPYRLQNGSVDGATLVLTDITEALSLERQ
LAAERERLELAVKAGGIGVWEYSPDAGTVVVDSTAGTMFGLAPDAPHPTAALAASVLPED
RPGFEAALSEAAHGLDEFEARIRVRAADHAPRHIRSYGRLTRSGDRKRIVGVCIDVSPEY
ALAETRDLMLREMNHRVKNLFAIIGGMISAGARTHRKIGVFATDMRDRISALGRAHSLAD
PSDGQGMSDLAGLIGATLRPYRDHVPTVIEGPLVAINWRHVSSLAMILHEWATNSVKYGA
LGSDDGALSVTWDRQADGLVLDWCERVARVAEPRPGRGFGTLLVEMSLRQLEARVTRSHD
ASAYRITLHLPELVLTRG
Download sequence
Identical sequences A0A0N0B6B7
WP_053622250.1.35747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]