SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_054013386.1.29195 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_054013386.1.29195
Domain Number 1 Region: 118-436
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.95e-58
Family Pancreatic carboxypeptidases 0.014
Further Details:      
 
Domain Number 2 Region: 536-650
Classification Level Classification E-value
Superfamily PKD domain 0.0000000004
Family PKD domain 0.0045
Further Details:      
 
Domain Number 3 Region: 659-740
Classification Level Classification E-value
Superfamily PKD domain 0.000000235
Family PKD domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_054013386.1.29195
Sequence length 741
Comment hypothetical protein [Pseudoalteromonas sp. R3]; AA=GCF_001282135.1; RF=na; TAX=1709477; STAX=1709477; NAME=Pseudoalteromonas sp. R3; strain=R3; AL=Scaffold; RT=Major
Sequence
MKKSLLGLLLLGTVSTMTAAHKGAQIDQSSAYLPSNLSQSIYQLVFTSDEQKANYLAQYH
DAMIEVRDRYLLLTLTQSEADTLRNAGALIFSRPDRAAQSHVSPNTHTRSVSMEQESGIP
NFPCYPTLAETHQMAQQLANTYPDFVELKQIGPSWEKSQGLGGHDLTVLILKNKKKNKWR
KRPALYMQGALHAREYTPGATTIKFAKYLLENRETNADVNWILNQREIHILLIANPDGRG
LAEQGLLWRKNTNSAYCAIDESMRGVDLNRNFDFAWASPIGGSTDDQCATTFHGPSAASE
PETQAIQAYLHSLFRDRRGDQITDPAPLNTQGVFLDLHSFSRYVMWPWSSELNPSPNEPQ
LSMMGHRLAAYNNYLAFQTKERFKAGGSADGYAYGQLGVAAFTFELGNTFFESCANFEGE
IFPNNLNALIYAAKVANRPYKLPGGPQIVDLRLQGADREAIPAGAPVQIKAIIADDHFGP
SLTGDAPPSEAIKRVELTIKKKGRQVKHRIMLPAADGLFDSAREAIDYTLDTSRWRNGKY
TLTLRAQDIAGQWGTKYAKFLIIDNSVDGVNTMPVADFTSQCRFGMCAFNGAVSQDDREG
LTYRWTFEGERFYGTYHGQQVEIEYFAAGIYSLTLQVEDSHGYRDIKTVHLELDGLRPPV
GQFEYQCNGLTCEFNSSASYDPDGEIIERYWQFGSDAPFAPGAEKMTYTFPQAGEYRIAF
VVVDNHYEFHEIYRTISVGNN
Download sequence
Identical sequences WP_054013386.1.29195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]