SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_054534555.1.4816 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_054534555.1.4816
Domain Number 1 Region: 1-170,223-325
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.43e-26
Family ABC transporter ATPase domain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 733-838,872-1018
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.19e-17
Family ABC transporter ATPase domain-like 0.012
Further Details:      
 
Domain Number 3 Region: 465-560
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0000000017
Family Rad50 coiled-coil Zn hook 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_054534555.1.4816
Sequence length 1023
Comment hypothetical protein [Herpetosiphon geysericola]; AA=GCF_001306135.1; RF=representative genome; TAX=70996; STAX=70996; NAME=Herpetosiphon geysericola; strain=DSM 7119; AL=Contig; RT=Major
Sequence
MLPEKLRVRNFMCYRDDVPTLDLEGIHVACLSGENGAGKSALLDAITWALWGKARVSSDD
ELIALGAQEMEVDLQFSVANNRYRVLRRRSSAKRGQTILEVQIETNGGWRAISGNSIRET
QEVIHDVLRMEYDTFINSAFLVQGKADEFTRKAPAERKRVLAEILGLDDYDKLEARAKEQ
VRYFSDRAQGLEGTITSYREWVNKRDFYLSQEAEAQHRVQQLGQEIEQASTIFEQADQQR
RALETRKAERDRELGRSRDLERQITESDADYRQLAQDIGVAQAIVERQSEIETNFQALKT
ARDDLVVLDQLREQILQLNDQRKEQLALVEREEVALQHQLQQHQRDQQTNAELIANKPSK
QADLAALAEQLASFADAQDQLQQARNQRSELEQQSTNLTQLHVEVQRLQGLINVRGDSLI
AAREEQNRRIIEADNFLANESRWRSEFETSIAQQKALIRDERKLQEMRSRDQQDAKQLGE
LSAQESNLEQLGKQINDKIVQLQATHDTHCPLCQSEIGHHGIQQVIEQYTVERDDMRAQY
REAKQARKQLSNEYEARQREIQGLERKVAQLSTLAATVGRLEGQLSEAQEQRNKRSEAES
TLRDLNQRIEHGDFAHEERTALAQAQAEISELGIDQQALDAQRQANNQLIAQLEQRLAQR
GAIEAKAAVLHEQLERIQAAETQNAALHETILSLQVQLDSRQFAQAAQQQAEAIYQQMAD
LGYASQRHQEVREAVASLGHWEGEYHQLRSAQTNLANNQRQAQRLAELIERQRQDLAQVQ
VTIQQLNQELAQLPAAVQAAETAQRTINEFRGRLAVAQKDLGAAQQNVQHVAQVAEQLAD
AEKELLRVQEQRDIHNELVKAFGKKGIQAMLIETAIPELEREANELLSRMTDNQMHLRFE
TQRETKKGDTSETLDIQIADEQGTRRYDLYSGGEAFRINFAIRIAMSKMLARRAGANLQT
LIIDEGFGSQDGRGRERLVEAITQVQADFNRILVITHIQELKDQFPVQIEITKYDDGSRW
AVN
Download sequence
Identical sequences A0A0P6YU33
WP_054534555.1.4816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]