SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_055508795.1.16144 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_055508795.1.16144
Domain Number 1 Region: 107-303
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.56e-19
Family 4-alpha-glucanotransferase, N-terminal domain 0.021
Further Details:      
 
Domain Number 2 Region: 541-980
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.000000000000279
Family alpha-mannosidase, C-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_055508795.1.16144
Sequence length 1000
Comment hypothetical protein [Nonomuraea sp. NBRC 110462]; AA=GCF_900109355.1; RF=representative genome; TAX=46177; STAX=46177; NAME=Nonomuraea pusilla; strain=DSM 43357; AL=Scaffold; RT=Major
Sequence
MTSRLLQRSLGSPDYDGIRQALRDGTSTPVISLRGLEVRVSVLPLFTHDGRQAVRVTSTE
PLTHVLVDADSATGSDVTLLVPEHDAPRVYTLESRDDAGVVGTARVTVTPQRRWTVFVVH
HSHLDIGYTDPQGTVLRHHLDYLDAALRLAEETASWPDDARFRWTVESSMPALRWLDARP
ADQVESFAAHAREGAIEVTALPFQLHTEACSTEELYRQLRFTTRLRRRYGFATRSAMHTD
VPGAVVGLVDALGAAGVRYLAAAHNWAGRSVPYLHGGEKLTRPFRWRAPSGNELLVWFTD
TPHGMAYMEGNTVGLTDSYELAEDLLPRYLSALATRGYPYGPGTFGWQGPDAPREPYELD
VLHLRVQGAHADNAGPSIVPASIARRWNERWAYPRLRSAVNSDFFEHVEERHLDRLAVHE
GDWTDWWADGLGSGARPLGYVRRAQSALRAAETLYAIAGVDASEAVEAAYDKVALFNEHT
WGAANPWEDAEEAGDSGGLQWTRKSSGAYQAQDDAADLLHAAARRFAAALSESGPAGDAL
ASFAVFNPGTAARTDVVRAFLPRDVVALDVPIALVDTRTGETVPHHEEVVDPDEWPTRPI
GRHVEAVLRDVPGVGHVRLDVVPGREQAPEPAALGGDAVIENEFYRVAFDVREGYVSSVF
DKAAGRELVNADAAAGFGQYVHDRYATAPHFNHLSGHVGAHDRTLLGDRDIGRNATVVRA
RRTAVGEELVVELRGKGVDWLRVTLELRRGVPRLDLTYRLAKQGTPAKEAVFLAFPFAAG
AATAWELTGGVGGPGVPRVPGSAEYMLPIRHWIAFEDPELTVAWATLEAPLVQLGTIHMP
YAPFPPTLDEEPGTVYSWALNNIWDTNFPAQQQGETTFRYAVASAAGAPGRRLGELAAAG
LTEPFVAALVTGGPESATYASVDHPDVLVTSIGRAGDERVVRLRSLAADPVRVRVRVPGL
LAARVSAGLDHDMEPLDVEGETVEVRLPACGVAAVWGTCA
Download sequence
Identical sequences A0A1H8CZH3
WP_055508795.1.16144 WP_055508795.1.29764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]