SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_055544028.1.59399 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_055544028.1.59399
Domain Number 1 Region: 122-335
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 9.45e-24
Family alpha-mannosidase 0.057
Further Details:      
 
Domain Number 2 Region: 561-648,687-1021
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.04e-20
Family alpha-mannosidase, C-terminal domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_055544028.1.59399
Sequence length 1056
Comment alpha-mannosidase [Streptomyces kanamyceticus]; AA=GCF_001418465.1; RF=na; TAX=1967; STAX=1967; NAME=Streptomyces kanamyceticus; strain=NRRL B-2535; AL=Scaffold; RT=Major
Sequence
MTTRALVRTTDWDNDRIRASLRSSVVGAEGGLADGTALRLTEEPLLRRADDGTLLQSLRV
EPVNGTVLPAELSVRTESGTVLRAERIAGPGRSVRLLLPAVDTATRVTVGLPEAPDGGIE
IQLTPQRRWTLHLVHHSHLDIGYTDPQGHVLAEHLSFLDSCLELTRATDDWPAESRFRWC
VESLWSFRQWADARPAEQVEEFVRRVREGRIELTALPFNLHTETCSTDELHELLRLAHDI
RDEHGVEFTSAMQTDVPGAVVGLVDALAAAGVKYLSVAHNWAGRSVPHLVGGEKLPRLFR
WRAPSGNSVLVWVTDTPHGLAYMEGPLLGFDTDYADVDDLLPAYLTSLATHPYPYRGGIF
GWAMDHTEIKREPYPWDVLHLRVQGKFGDNAPPRRIIADTVRRWNETWAYPQLRLSRNED
FFTDAEARLGDEIRTFEGDWTDWWVDGVGSGARPLSLARTAQSVVADAQTIGTFAALLGA
TGAEDDGKDAAGVYEAVSLFDEHTWGAGDPWTHGDEGGHSGEHQWHWKYGQAVRAHDDGN
ALLAKASARLGQRLTAPPGAAAAYHVVNTCSWPRTDVVPVFLPESTVALAQQVTVTDARD
GRRLVHEERPQTNDDHRDAGRFLLVRVDDVPPAGSVRLDITAVAARTGTDDEATTVKAAT
GWNPTGGTEREDPAETAAEALAHPDPTLLENEHLAVRVDLAHACIASIVDKATGRELVRE
DAVVGFNGYLHDSYTTAGAFNHNSSRTTGSERLEHLGARAVAPPAALIARRSTPTAASLT
YETRPAGANRLRTTLTLPHGVARLDIENRLDKDATPGKESAYFAFPFSFEDPAVRMEATG
GATGSGLPVVPGSALHMRAVRRWVTLRDEGLAVAWSTQDAPLVQFGNIALPYAPFPKTLG
HDEPATVFSWIHNNLWDTNFPSAQGFEFTYRYSLACAPKDDGLGPRTAAAWSRPLRAVRA
RGPVGEAPKEHAFAELGDPRVRLVGATTPASGDVLLRLQSFAEEPVACRVRARFPVAAAH
RATFLGAAGDELPCADGEVTVHIPALGTTAVLFVRP
Download sequence
Identical sequences WP_055544028.1.59399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]