SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_058798177.1.12094 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_058798177.1.12094
Domain Number 1 Region: 119-437
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.3e-60
Family Pancreatic carboxypeptidases 0.018
Further Details:      
 
Domain Number 2 Region: 659-739
Classification Level Classification E-value
Superfamily PKD domain 0.000000000011
Family PKD domain 0.011
Further Details:      
 
Domain Number 3 Region: 537-649
Classification Level Classification E-value
Superfamily PKD domain 0.0000000235
Family PKD domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_058798177.1.12094
Sequence length 742
Comment hypothetical protein [Pseudoalteromonas rubra]; AA=GCF_001482385.1; RF=representative genome; TAX=43658; STAX=43658; NAME=Pseudoalteromonas rubra; strain=SCSIO 6842; AL=Complete Genome; RT=Major
Sequence
MKKNLLGMLLLSTISVAATAHSDPHVANIQVSPADNHTLSTYQLAFSSEAQKAEYLSRFH
TAVLQVANSYLVLSLTQQEFAELHSAGALIFSKPGESNLPEAAVQGAISRAQSPVQESGI
PNFSCYPTLAETQRMAQTLAQTYPDFVELKHIGPSWEKSQGLGGHDLTVLVLKNKKKNKW
RKRPALYMQGALHAREYTPGATTLKFAQYLLENRETNADVNWILNQREIHILLIANPDGR
VLAEQGQFWRKNTNTAYCALDETLRGVDLNRNFDFAWASPIGGSTDDQCAATFHGPSPAS
EPETQAIQAYLHELFKDRRGDLLTDPAPLNTQGVFLDLHSFSRFVMWPWSSELTPSPNAD
QLSMMGHRMAAYNGYWAFQTQEIFKAGGSADGYAYGQLGIASFTFELGNEFFESCANFEG
EIFPNNLNALIYAAKVAKRPYKLPAGPQFFDLRLKGAGEEAVPAGTPVEIIATVADDLFG
PSLTGQLPPSQAISKVELTIKKKGKRGRKRILLPAADGAFDTVSESLNYTLDTHRWRNGR
YTLTLRAQDASGQWGPKYAKFLTIDNEAMPGTQSPVADFIADCRKGICGFDGSVTQDDRD
SLTYTWVLQGGQFFRVFHGEQVEIEYTLAGDYQLTLQVDDSHGNRDVKVVPLELDGVIPP
VTQFSYQCTGLICEFNSSASYDPDGEIVERLWRMGNEPYISGAETVVHTFPAPGEYIVVF
VAIDNDGQFSQVAQTIQVTSNE
Download sequence
Identical sequences A0A0U3IB06
WP_058798177.1.12094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]