SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_059126437.1.21785 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_059126437.1.21785
Domain Number 1 Region: 123-334
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.33e-23
Family 4-alpha-glucanotransferase, N-terminal domain 0.09
Further Details:      
 
Domain Number 2 Region: 560-648,687-747,788-1029
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.71e-20
Family alpha-mannosidase, C-terminal domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_059126437.1.21785
Sequence length 1057
Comment alpha-mannosidase [Streptomyces sp. NRRL F-5122]; AA=GCF_001507435.1; RF=na; TAX=1609098; STAX=1609098; NAME=Streptomyces sp. NRRL F-5122; strain=NRRL F-5122; AL=Contig; RT=Major
Sequence
MTTRALVRTTDWDNDRIRDSLRGSVVSAEGSLGGSALRLTVEPLLRRAGNGGLLQSLRVE
AVNGSRLPDELTVRTESGSALPAERIAGPNRSVRLLLPAVDTAQRVTVGLHGSDPDSGID
VTLTPQRRWTVHLVHHSHLDIGYTDPQGRVLAEHLSFLDSCLELTRATDDWAPESQFRWC
VESLWSFRQWADARPAEQVEEFVRRVREGRIELTAMPFNLHTETCSTDELHELLRMAHEV
RERYGVDFTSAMQTDVPGSVVGLVDALSDAGVKYLSVAHNWAGRSVPHLVGGEKLPRLFR
WRAPSGNSLLVWVTDTPHGLAYMEGPLLGFDTDYGSVDDLLPSYLTSLASNPYPYRGGIF
GWAMDQEEIKREPYPWDVLHLRVQGKFGDNAPPRRIIADTVRRWNETWAYPQLRLSRNED
FFADAESRLGDQIRTFEGDWTDWWVDGVGSGAHPLSLARTAQSVVADAQTLGTFAGVLGA
AGAEDDSRDAAGVYESVSLFDEHTWGAGDPWTHGDHGGHSGEQQWHWKYGQALRAHDEGQ
SLLNRAAARLGQRLASPAGVPASYHVVNTCSWARTDVVRIFLPESSVPLEQPVVVRDGRT
GAHLHHEERPQVNDDHRDAGRFLLVRVDDVPPAGSVRLDIRIAEEAIGDAAEEAVLKAAT
GWNPTGGTEREDPAETAAAAYALAEPLLLENEHLAVRVDLARACIGSVTDKATGRELVRD
DAVTGFNAYIHDSYTTAGGFNHNSSRTTGSDRLEHLGDRSVAPPAALIARRSTTTAETIT
YETRPAGANRVRTTLTLPRGVARLDIENRVDKDATTGKESAYFAFPFAFGTPTVRMEASG
GATGNGLPVVPGSALHMRAVRRWITLREDEFTVAWASQDAPLVQFGNIALPYAPFPKTMG
HDEPSTVFSWIHNNLWDTNFPSEQGFEFTFRYSIACGGTDAGLGPRTAAAWSRPLHAVRA
RGPEPEAAPASLTFAELGDSRVRLVGATTPAPGRVLLRLQSFAEEPVACPVRAGFPVLAA
HRSNYLGTPSARLPLHDGEVTLDIPALGTAAVLLEHH
Download sequence
Identical sequences A0A101CGY9
WP_059126437.1.21785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]