SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_061084182.1.96808 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_061084182.1.96808
Domain Number 1 Region: 666-935,975-1074
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.92e-30
Family alpha-mannosidase, C-terminal domain 0.02
Further Details:      
 
Domain Number 2 Region: 272-568
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000723
Family 4-alpha-glucanotransferase, N-terminal domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_061084182.1.96808
Sequence length 1096
Comment glycoside hydrolase [Chryseobacterium indologenes]; AA=GCF_001544435.1; RF=na; TAX=253; STAX=253; NAME=Chryseobacterium indologenes; strain=mars15; AL=Contig; RT=Major
Sequence
MTGNGMYAQEKAPYFGNIQAINGYEREISGENIDYFSAFPDHANRALLTRTTDGKKTIEW
ETASVPLKNNVQYVYFNWLVSHSSGTSGGARNFDLYINDQKTLTLTTYPANQHPDWISKA
ADSTAFVFHQTKTDGLKDSYGIAYLRVPANKVTPGKPLRLKIVGQAQNSRDWMMTYKFTF
QEKIDAQSTPFLLKDGKRLLSLTTLHFGPEEKIKAIINNKETFTFTMPDGIKTFDIPVSL
SAEGGKLELVVTSGRKELLRKTIQAQAIVPRTLYFIHHSHTDVGYSHLQSEVEKIHTKNI
YDALAMIEKTKNLPEEARFKYNVEALWDVENFMKNASAQDKKSFVKAVQEGGIGLSAMYG
NILTGLSQPEELFHYTEYAQKLEKELGLPIKSAMMSDVPGFAWSLVPALTSSGVKYFSSG
PNYLGKTNPYLGDRVGNFVKNWGDKPVWWQSPSGKEKILFWTAGRGYSSWHGVHPGDVFD
NGQKKIAEYLEDLTHTNYPYDMVQWRYNIVADNGPIDPTVSQFVDEWNKKYTSPKIVLST
NEKMFEVFEKKYGDKIPVVKGDISPYWEDGAMSTAKEEGINRNSSLKLQQLTTLYSILNP
RQYNSRHFYEAWKNVILFHEHTWGAFNSITAPDLPFVADQWKVKKQFSADGSFLSEKLEK
ELLLPLTDPASKTIEVFNTSSWAREGIVTIPENTQANAVQDATGQKIPLQKLQDGTMTFL
AKNIPALGSATYTLIKNKISSPSSFIITDSSISNGKVTVSWDKKTGSITHLTDTTKTNYA
GSFNDQGLNSYWYVPGSDPKEALSNTDVQVKILENGPVVAKISLVSEAPGARKLERMITI
TAGSDEIALENIVDKKPVRTKEAVHFGFPFNPDFKNITVDAGYGNMKYLTDQLPGSNMDY
WYSRRWVDASSAQKGIQWMMLETPLIEAATMIDERMVIDNSHKKWKDNGTPGTTNWFSYA
MNNYWHTNYKADQEGPVHYHYVLRPHDGFNSFENEKSAAAFTQPLIAVPVKEQSFSSGSL
FHMNNDKIVVTSITPQEDQSFIIRLYNPDEKGQIIAFQWEKLKPVKLINLKTGKEFPITE
KFSLEGMDVLEIKLIF
Download sequence
Identical sequences WP_061084182.1.96808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]