SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_061448495.1.5909 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_061448495.1.5909
Domain Number 1 Region: 210-549
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.69e-21
Family Quinoprotein alcohol dehydrogenase-like 0.0033
Further Details:      
 
Domain Number 2 Region: 121-206
Classification Level Classification E-value
Superfamily PKD domain 1.16e-19
Family PKD domain 0.0021
Further Details:      
 
Domain Number 3 Region: 36-119
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000432
Family PKD domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_061448495.1.5909
Sequence length 587
Comment hypothetical protein [Bacteroides ovatus]; AA=GCF_001578575.1; RF=na; TAX=28116; STAX=28116; NAME=Bacteroides ovatus; strain=KLE1656; AL=Scaffold; RT=Major
Sequence
MNRMIMKKYIFLIVTVVCLFACKDGDEVRQTTSLEASFSIDKEEYTVGDIVYLTDESVKT
EGEIVEYFWHFGFEGEGNRATTKDASVLYKKAGTYVIKLTVTDEFGGYATASHTVVIRPT
NMPPVTDFSYSPAICKVNEKVQFTDKSVDEDGEVVAYEWDFGNGQTSQEKDPEITFTTTG
FVTVKLTTTDDRGATNTKQATLYVRDTSISGVTILWDKTFETSSSLRSISPAVGDNGDVY
VSSNALHLFAYSPSGEQKWMFDLSKDGGAGNQGSSPMVGADGTIYMGASTTDKNISSSLY
AIHPDGTQKWRYELGIGTNIPYISPALSRDGNILIGNRGTDGSVHMVDRSSGRQLWRRKS
PNGGANGGISVGQNGVIYSALSGANGFARTTQDGVNLSPNLGKGNTAAAVYPAIDAQGNV
YVAFSEGVVAAYDNQGNELWRYPASGTMGKIDQGGPAIGADGTIYVGTKNPNAQVVALTK
GGAKKWSYSSVAEIGTTPAIDSDGNIHICDDDGNYIILNADGTEKYKRQLGSKIWSSPVI
ADYGIVYVTYEDNGACKLIAIDCGIEGPANSPWAQRGQNAKRNALQK
Download sequence
Identical sequences A0A139KSB4
WP_061448495.1.5909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]