SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_062037157.1.67614 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_062037157.1.67614
Domain Number 1 Region: 666-1079
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.44e-24
Family alpha-mannosidase, C-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 274-554
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.48e-17
Family alpha-mannosidase 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_062037157.1.67614
Sequence length 1123
Comment hypothetical protein [Lentimicrobium saccharophilum]; AA=GCF_001192835.1; RF=representative genome; TAX=1678841; STAX=1678841; NAME=Lentimicrobium saccharophilum; strain=TBC1; AL=Scaffold; RT=Major
Sequence
MKTKVLLFVFALLSAAVFGQNPLTGNTTIINGYGSEVYGPDFDYHSSIPIAESCMIIRTT
DGSDSMEWLTDPVPAGVNTENISFVWLAGIGSSPGIGDFSIEVNGKPAFTIIADGSDEWT
HHASDGSSLYFSKDMVDQHGDRFGFVYLTVPAKNLKAGEKLSIKATGAGLNKTTWLMTFR
FKVENGILLKALPALKEKDGKQYQLGVAVILHLGKESPVRFFMDGKLIQETTLNFGYNYI
KLDLPAVNKAKKVNYRVETEADTWKGVLELKPVKKWRVNFVQHSHTDIGYTRSQTDILAE
HLRYIDYALDYCDNTDLYPEEAKFRWTCEASWAVDEYLKSRPAAQTERLKQRVAEGRIEL
TGMYFNFDELPDEQTLAASLRPVSLIKSKGMEVKTAMQNDVNGIGWNFCDYYHDLGIKYL
NMGTHGHRALICFDKPTLFWWESPSGNRMLAFRAEHYMTGNTVFKIHAGDFNVFEDKLLT
YLTELEAKGYAYDLISIQHSGFLVDNSPPSTHASEMIRQWNEKYTWPKLQTATATSFFEE
MEQKHGHEFQVIRGAWPDWWTDGFGASAREVAASRQAQGDLIANSAGLSMALLQGAALPE
KITDRIDATNSALLFYTEHTVGYHNSVREPYHKYTLEQRRIKESYAWEAARRARMLGEET
MGLLQHFVEREKEPSLIVYNTLNWKRSGLLRVYIDHQILPRYTPFAITDQQGNEAKAQPV
EQHSDGTYYAIWVDDVPAFGYKKYIIKVDKSAKIATVPEARKAISSLENKWYHIDLDVAR
GAISSITDKELNLQLVDSKAKYSFGEFIYELLNNRTQMESYKLTNFTREGLDSVWYDGYE
TGEVWNTLKFRGNTPAAQRDQTYVFEIRLFNTAKRIDLFYAIEKKLVTDPEGIYIALPFA
LDGGQLALDVPGGEMRAGIDQIPGSSNDWNTLQTYARLYNEQAQLVVSSVEVPLMQFGNI
NTGRFKAGALPETTHMFGWPMNNYWVTNFNADQHGGHEWLYSITSLKGNSMQDAARFGRG
HRTPMPARVLPGGGNGEAQWENSLLTGLPDHVMLISAMPAADGRSILLHLRETAGKTGTI
APQYASQRELLPCVRTDVNGTPLAGNSNEIKALESAFFSVIVR
Download sequence
Identical sequences A0A0S7BV77
WP_062037157.1.67614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]