SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_062698159.1.47762 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_062698159.1.47762
Domain Number 1 Region: 654-923,975-1060
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.45e-31
Family alpha-mannosidase, C-terminal domain 0.0072
Further Details:      
 
Domain Number 2 Region: 272-558
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000000206
Family 4-alpha-glucanotransferase, N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_062698159.1.47762
Sequence length 1096
Comment glycoside hydrolase [Chryseobacterium indologenes]; AA=GCF_001295265.1; RF=representative genome; TAX=253; STAX=253; NAME=Chryseobacterium indologenes; strain=CI_885; AL=Contig; RT=Major
Sequence
MTVHLVHAQKKVPYFGIIQAANGYSREISGENIGYYSIFPDYANRALLTRTTDGTKTIEW
ETDAVPQNTSGAYVYFSWLVSHSSGTSGGTRHFDLYINDQKTLTLTTYPVNQRPDWISKA
ADSTAFVFDQIKMDGLKDSYGIGYLRIPKNKVTPGKPVRLKLVGQAQDSRDWFMTYKFTF
QEKIDVHSTPFLLKDGKRLLTLTTLHFGPDQKITAKIDGKETYSFTMPDGIRSFDIPVPL
SSKGGITELVVSSGKKEILRKTIHADAIVPRTLYFIHHSHTDVGYSHLQAEVEKIHTKNI
YDALKMIEETRNLPEEAHFKWNVEALWDVENFMQKATPEDKKAFAKAVKEGGIGLSAMYG
NILTGLSQPEELFHYTEYAQKLEKEFGFKINSAMMSDVPGFAWSLVPALASSGVKYFSSG
PNYLGVSNPYLGDRVGNFVKNWGDKPVWWQSPSGKDKILFWTGGRGYSSWHGVHPGDVFE
NGQKKIAEYLEDLVKTNYPYDMVQWRYNIVADNGPIDPTISKFVDEWNKKYESPKIILST
NEKMFEVFEKKYGDQIPVVKGDISPHWEDGAMSTAKEEGINRNSSLKLQQLATLYSMLNP
RQYNSKSFYEAWRNVILFHEHTWGAFNSITAPDLPFVKDQWQVKKQFSLDGSSITSQLEK
DLLHPITEQGSKTITVFNTSSWTRSGTVSIPGTDWGNAVKDASGNIIPLQKLQDGTMVFF
AKNIPPLGSANFSIVKNKITAAEHFSITGNSISNGKVTLSWDPKTGSITHFTDNSATNYA
GSFNSQGLNSYWYVPGSDPKEAVSSSAVQIKILEKGPALAKVSLTSDAPGAKKLERIITL
FADSNEIELENIVDKKPVRTKESVHFGFPFNTDFKNITVDVGYGTMKYLTDQLPGSNMDY
WYSRRWVDASFGQKGMQWMMLETPLIEAGEMIDERMVIDNSHKKWKDKGISGTTNWFSYA
MNNYWHTNYKADQEGPVRYRYALRPHAAFNPVENEKYAAAFTQPLIAIPVKEKSLTEGSL
FLMNNDKIVVTSITPQEDHSFLIRLYNPDENEQTTSFSWQKLKPSKVIHSRTGKVLSSNE
SLSLAGMDVIEIKVIP
Download sequence
Identical sequences A0A0N0IWS1
WP_062698159.1.47762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]