SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_063363226.1.10309 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_063363226.1.10309
Domain Number 1 Region: 118-414
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.63e-61
Family Pancreatic carboxypeptidases 0.029
Further Details:      
 
Domain Number 2 Region: 658-739
Classification Level Classification E-value
Superfamily PKD domain 0.000000000458
Family PKD domain 0.0076
Further Details:      
 
Domain Number 3 Region: 572-648
Classification Level Classification E-value
Superfamily PKD domain 0.000000017
Family PKD domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_063363226.1.10309
Sequence length 740
Comment hypothetical protein [Pseudoalteromonas luteoviolacea]; AA=GCF_001625695.1; RF=na; TAX=1365252; STAX=43657; NAME=Pseudoalteromonas luteoviolacea H33-S; strain=H33-S; AL=Contig; RT=Major
Sequence
MLKKLITTSMLLALGSVTLPLHAHTSSTDSVSSSQHMYKDYSVYFANEEQRIEYARKYHG
QIVDTLHNALIVSLSDKEFLSARSSGDIILEHTPPQPINRAANALVKASQNTPTPAQVSG
IPNFPCYPTLEETYELAEQLAAKYPNFVELKRIGQSWKKEQGLGGHDLTVLVIKNKKRNK
DKKLPTMYMQGALHAREYTAGATTIKFAQHLLENRRTNPDIKWILNQREIHILLIANPDG
RKYAELGKLWRKNTNTAYCATNEEQIGADLNRNFDFGWNSTPYSSDEQCSNTYQGPVAAS
EPETQVIQSYINSIFEDNRGELDTDAAPLDTAGLFIDIHSHGGMIMWPWSHLRTPPPNST
GLSMLGHRLAAYNGYAAFQVGNRFHVSGSADGYAYGQLGVASFTYELGREFFEHCGNFEG
EIFPNTLKSLIYAAKVAKAPYKISGGPQILDYKLEGAGNVAIPPGTPINLTAGIYDDFFG
RQTYTPLPPSQAIKKVKLIIKKQGEGIVQRLKLPAADGIYDSPQEQLNYALDTSDWDDGR
YTLILKAQDVTGQWGVKYAKYLTIDDDASTQNQAPVADFTPTCTYGTCQFDASKSTDDKP
GLKYRWFIGSETYRQEYSGEKIEYVHEMAGTYYVTLVVEDANDISAVKHAVFDLDGKYLP
IANFTYQCSNLTCEFDSSSSTDPDGQITERLWNFGVDGLYLPGNVKETFTFPVAGEYRVA
FVAYDNDGLYHETFQFITVN
Download sequence
Identical sequences A0A167CV91
WP_063363226.1.10309 WP_063363226.1.2732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]