SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_063366270.1.94671 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_063366270.1.94671
Domain Number 1 Region: 118-414
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.61e-60
Family Pancreatic carboxypeptidases 0.021
Further Details:      
 
Domain Number 2 Region: 659-739
Classification Level Classification E-value
Superfamily PKD domain 0.000000000288
Family PKD domain 0.0094
Further Details:      
 
Domain Number 3 Region: 572-648
Classification Level Classification E-value
Superfamily PKD domain 0.000000275
Family PKD domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_063366270.1.94671
Sequence length 740
Comment hypothetical protein [Pseudoalteromonas luteoviolacea]; AA=GCF_001625685.1; RF=na; TAX=1365248; STAX=43657; NAME=Pseudoalteromonas luteoviolacea CPMOR-1; strain=CPMOR-1; AL=Contig; RT=Major
Sequence
MIKTLIKTSLIATLGALTLPSHSHTHVENNIRAQQPNNLNYSLYFSNEDQRVTYSRQYHG
QIVESLHNALVVSLSEQEFLLARSSGAVILEHTPPKTINRAANELVNANQSILTTTQTSG
IPNFPCYPTLEETYELAEQLAKKYPNFVELKHIGQSWKKEQGLGGHDLTVLVIKNKKRNK
NKKLPTMYMQGALHAREYTAGATTIKFAQHLLENRRTNPDIKWILNQREIHILLIANPDG
RKYAELGKEWRKNTNTAYCATNEEQIGADLNRNFDFAWNSTPYSSDEQCSNTYQGPVAAS
EPETKVIQNYINSIFEDNRGDLDTDAAPLDTAGLFLDIHSFGGMVMWPWSHLRTPPPNSA
GLSMLGHRLAAYSGYVAYQVGNRFHVGGSAGGYAYGQLGVASFTYELGREFFEHCGNFEG
EIFPNTLKSLIYAAKVAKAPYKISGGPQILDYKLEGAGDVAVPPGTPINLTAGIYDDFFG
NQSYTPLPPSQAVKKVKLVIKKQGEGVVQKLKLPAADGIYDSPREQLNYALDTSNWDDGR
YTLILKAQDVTGQWGVKYAKYLTIDDDASAQNKAPVADFIPTCTYGSCQFDASKSTDDKP
GLKYRWFIGSEISREEYTGEKIEYVHEMAGTYYVTLVVEDANDISAVKHAVFDLDGKYVP
IANFTYQCAGLICEFDSSSASDPDGHIVERLWRFGADAMYLPGKVKETFTFPTAGEYRVA
FVVRDNDGQYNETYQFITVN
Download sequence
Identical sequences A0A167NG32
WP_063366270.1.94671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]