SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_064185449.1.73780 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_064185449.1.73780
Domain Number 1 Region: 148-251
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000458
Family Myosin rod fragments 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_064185449.1.73780
Sequence length 256
Comment hypothetical protein, partial [Klebsiella pneumoniae]; AA=GCF_900084165.1; RF=na; TAX=573; STAX=573; NAME=Klebsiella pneumoniae; strain=k1100; AL=Scaffold; RT=Major
Sequence
MNRAATLTLNAPLLMLVAALALSTPFTAGAAPAFLDYAQQQTQQSQAQEKNDAASAKQTQ
ENRQSADNKKTGTSTSQLQKRITSQQAAIAQKDKLIQQLKKQLAATPQTDTAGANEQAAL
NKRINELQVALSAATAEKEALIKKAGVVQNNNLKQSQAAARQQIQQLTTQIQQAEAENKR
LSASFTTLNKDKHALMTRLAAAEKEKQAALEQVKALNADKQPLTTRLAAAEKEKQAVLEQ
VKALNADKQSLTIRLA
Download sequence
Identical sequences WP_064185449.1.29120 WP_064185449.1.73780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]