SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_065082852.1.39683 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_065082852.1.39683
Domain Number 1 Region: 657-935,975-1060
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.71e-28
Family alpha-mannosidase, C-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 272-557
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.0000000000372
Family 4-alpha-glucanotransferase, N-terminal domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_065082852.1.39683
Sequence length 1096
Comment glycoside hydrolase [Elizabethkingia miricola]; AA=GCF_001675285.1; RF=na; TAX=172045; STAX=172045; NAME=Elizabethkingia miricola; strain=GTC_862; AL=Contig; RT=Major
Sequence
MTGNFIYAQKKVPYFGNINAINGYENEISGENIDYFSAFPDHATRALLTRTTDGAKIIEW
ETAKVPQKSSAPYVYFNWLVSHSSGSSGGVRNFDLYINDQKALTLSTYPANQHPTWISKA
ADSTAFVFNQTKMDGLKDSYGIAYLRVPINKVTPGKPLRLKLVGQAQNSRDWFMTYKFTF
QEKMDASATPFILKDGKRLINLTTLHFGPEEKITAKIDNKESFSFTMPDGIKTFDIPVTL
SQTGGNVQLTVTSGKKELLRKTIQAGTIVPRTLYFIHHSHTDVGYSHLQAEVEKIHTKNI
YDALKMIDETRNLPEEARFKWNVEALWDVENFMQKATPEDKKAFVKAVKEGGIGLSAMYG
NILTGLSQPEELFHYTEYAQKLEKEYGLKINSAMMSDVPGFAWSLVPALTTSGVKYFSSG
PNYLGKTNPYLGDRVGNFVKNWGDKPVWWQSPSGKEKILFWTAGRGYSSWHGIHPGAVFE
TGQKKIAEYLDDLTRTNYPYDIVQWRYNIVSDNGPIDPSISKFVDEWNKKYTSPKIVLST
NENMFEVFEKKYGDQLPVVKGDISPHWEDGAMSTAKEEGINRNSGLKLQQLTTLYSMLNP
RLYNSQRFYDAWRNVILFHEHTWGAFNSITAPDLPFVTDQWKVKRQFSLDGNSLTNQLEK
DLLQPLTNPGSKKIEVFNTSSWIRSGVVTIPAAAEGNSVQDAAGNKIPLQKLENGTMVFM
ANNIPALGTAVYTIIKNKTLATSPFVVTNNSVSNGKIALTWDNKTGSITHFTDNGATNYA
GSYNNQGLNSYWYVPGPDPNEAKSNTEVHTKILENGAVMVKVLLTAEAPGANKLERIITL
YKDSDEALLENIVDKKPIRTKESVHFGFPFNSGFKNITADAGYGIMKYLTDQLPGSNMDY
WYSRRWVDASSGQKGIQWMMIETPLTEAAEMIDERMLIDNSHKKWKDKGTPGTTNWFSYA
MNNYWHTNYKADQEGPVHYRYALRPHDTFNSVENEKYAAAFTQPLIAIPVNYKADIKGSL
FHMKNDKIVVTSITPQDDQSFIIRLYNPDEKEQTTTFTWERLKPSKLIYNKTGKEISIND
SISLNSMDVTEIKAIQ
Download sequence
Identical sequences A0A1A6CAJ9
WP_065082852.1.38267 WP_065082852.1.39683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]