SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_065489471.1.31987 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_065489471.1.31987
Domain Number 1 Region: 120-330
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 3.17e-28
Family alpha-mannosidase 0.0075
Further Details:      
 
Domain Number 2 Region: 562-1005
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 7.22e-20
Family alpha-mannosidase, C-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_065489471.1.31987
Sequence length 1034
Comment alpha-mannosidase [Streptomyces sp. PTY087I2]; AA=GCF_001687325.1; RF=na; TAX=1819298; STAX=1819298; NAME=Streptomyces sp. PTY087I2; strain=PTY087I2; AL=Scaffold; RT=Major
Sequence
MPRPELVRPSWWDSNMARDILRDRAVSAEGVLGGHRIRLACEPLLRHDGAGGLLQSVRVT
AGRPLTRARVTTVNGTALRCDVLPGPGSDLRLLLPEVESPTPVLVELPELADGENVEVLL
TPQRHWTLHLVQHAHLDIGYTDPQSTVLAEGRTYLDSLLELCRTTDDWPDASKFRWAVEG
FFSYENWSQNRPARQVAEFLDRVREGRIELAAMPFNLHTETCSTDELHELLRPVRELRDQ
RGIDITTAMQTDVPGQVVGLPDVLADSGIRYLSVAHNWAGRAVPHHTGGQDLPRLFRWRS
PSGREVLVWRTDTPHGLAYMEGSILGFDESFDRVDDLLPNYLTALANHQYPHEGRGIPGF
PVLDEEFKGDPYPWDILHLRVLGKFADNGPPRRVIADTVRRWNEEWAFPVLRTSRNEDFF
TDAEQRLGDRIETFEGDWTDWWVDGVGAGAVPLAATRDGQAALADAQTLAGYAQTLGASE
GARITEAAPEVYRAASLFNEHTWGAGDPWTHGDHGHASGERQWHWKYAQALRAHDGARTL
LDAASAALGERLSPREGTLAGYYVVNTCSWERSETVRLFLPESTVPLTDPVRVVDSRDGT
PLEVTEEAQSNELHRAAGRFLLFRLAGVPAHGAVRVDIEPASASSAESSAQDGARAHAST
VLENEFLRVHVDLASACIDSIVDKRTGNELVRQDATVGFNGYLYDEYATAGGFNHQSSKT
TADDSMHLLATRRTAPPAALVERTSDATGETLVYACAPPGARRLRVTVHLPRASARIDLE
NRIDKTATLTKESAFFAFPFAMDSPVVRMEATGGATGTGLPTVPGSAQHMRAIRRWVSLQ
ENGISAALATQDAPLIQVGGVAIPYAPYPQSLAQEEPGTVFSWVHNNIWDTNFPSEQAFD
HVFRYSVGWQDEPAPGGAVLGMRTAAVGSRPLVPVRAGRTPEADPGSTYALLTLDDPRVR
VVGLTVPEPGRLLVRMQSFAEEPVICRLTPGFAVTAAACADYLGTAGATLRTEADGSLPV
PVPRLGTTAVSLTM
Download sequence
Identical sequences A0A1B9EKB6
WP_065489471.1.31987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]