SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_066206117.1.11382 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_066206117.1.11382
Domain Number 1 Region: 657-1071
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.49e-27
Family 4-alpha-glucanotransferase, C-terminal domain 0.06
Further Details:      
 
Domain Number 2 Region: 274-571
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 4.67e-16
Family alpha-mannosidase 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_066206117.1.11382
Sequence length 1100
Comment hypothetical protein [Flammeovirga sp. MY04]; AA=GCF_001682195.1; RF=na; TAX=1191459; STAX=1191459; NAME=Flammeovirga sp. MY04; strain=MY04; AL=Complete Genome; RT=Major
Sequence
MNLKKKPILFSFILLQLILISNTFAQESKFLKGYTNYIHGDIMPYKSPQEDANKAMLVRC
EEGKEVMEWEAEEVPQNYNGKFVEFGLIMGVDIDRAQYNYDIYINDKKYFTFTAPEESIL
QDVETTGPNASTFTFKGTMIDAYSDLFGYGFLKVKTEDLPKGEPIRMKVVAPNVGKSSWM
MVFRYGVGGNVSWKQEPAVIKTKKGPKQQLRATVLHYGNPTDAVIIAGKEKKKVKLNVGA
NIFRIEVDKVTSSQDLHVQVKVGKEILDDRTLTVDPVKHYDLYLLHHSHVDIGYTHTQDE
VEKVQWKNLDDAVMMSQKTQDFPEGSKFKWSVEVMWAVESYLKNATPEKRAAFIEAVQNG
SIELDGLYGNMLTGLSNPQELVESTFDALEVSKEAGVPLESAMITDVPGYTWGMVPVLAH
SGVKYLSAGTNVFHRIGSTISTWGDRPFYWSSPSGEEKVLVWVHEKGYSHFHTGLGFTDL
KVLLTPKSVFDYLNELNERNYPYDITTLRYTVGSDNGPVDQGISETVKAWNEKYETPKVL
LSTTTESFKAFEDKYGDELPVVKGDFTPYWEDGAGSTSKETALVRNASEKLSQAMTLLSM
NDVEIPNKEFEQAWRYVLLYNEHTWGAYNSISEPEADFVHSQWAVKQSFAIKADSIADAI
LQKALASTKDEKGVTLTNTVSWERADMITLSAEQSQQGDIVLNRQGDVFPTQRLSNGNLA
VWIPTIPGFGSKEIFVTPGEASTVKKVINHENGFENDQIKVEINPETGAITSLYDKIRKK
ELADTKALKGINDYYYVKGRNPQSPLTTGNDVTIKYIEKGDLTSTIEISSSAPGTEEWKR
LITINAYSNEIAIENKINKTNIYDPEGVHIAFPFKVDGGTVRIDVPFGEYIPEKEQLPGS
CKNYFTVQRYVDVSNLDHGVTWASPDAPMIELGEITTDALSYGWVNEVKPTQTIYAYLMN
NYWETNYKASQDGWHDFRFVLKPHGAYVSSQAKKFSTGVSQPLLISENGNNEFLPLVRPT
SNQMIITAARPMKKDQVLVTVLNASAGDKELSLETSKQVKEIRVSNIHGDDLGAYQPNEN
VPGWGIRFLLIEKEPVKDIK
Download sequence
Identical sequences A0A1B1FPC7
WP_066206117.1.11382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]