SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_067195602.1.65128 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_067195602.1.65128
Domain Number 1 Region: 42-130
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00000000994
Family Apolipoprotein 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_067195602.1.65128
Sequence length 215
Comment hypothetical protein [Microbacterium sp. XT11]; AA=GCF_001513675.1; RF=na; TAX=367477; STAX=367477; NAME=Microbacterium sp. XT11; strain=XT11; AL=Complete Genome; RT=Major
Sequence
MYVSAEIIAVILSAVGIIVTLGAGMFAGFSWCVRRADAGDARLEERIDALDTRLTTKIDD
VEDKLTRRIDDVEDKLTRRIDDVENKLSTRIDDVENKLSTRIDDVENKLTTRIDDVENKL
TTRGEGLMEGQASLRSDMAVIAHQVGVLTSDVAELKADVTVLKADVTVLKAGVADLKGDV
TELKADVAALQSDMFEVKLAIARWEGPPRHLMLTR
Download sequence
Identical sequences A0A0U4FSG8
WP_067195602.1.65128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]