SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_068070033.1.81126 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_068070033.1.81126
Domain Number 1 Region: 125-433
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.97e-55
Family Carboxypeptidase T 0.013
Further Details:      
 
Domain Number 2 Region: 646-727
Classification Level Classification E-value
Superfamily PKD domain 0.000000000101
Family PKD domain 0.0082
Further Details:      
 
Domain Number 3 Region: 537-646
Classification Level Classification E-value
Superfamily PKD domain 0.000000285
Family PKD domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_068070033.1.81126
Sequence length 761
Comment hypothetical protein [Rheinheimera sp. SA_1]; AA=GCF_001669775.1; RF=na; TAX=1827365; STAX=1827365; NAME=Rheinheimera sp. SA_1; strain=SA_1; AL=Contig; RT=Major
Sequence
MHKMYWLTSLFISYPLYAAPLLDDPRLQDFQQQQLQQATEVRFATVELARAAAISHHDVL
LAGHWKDKVLVLQLDNKAKLQLTPFAVAMTPATQWQTAQAAAFSQSNNRSDSSQANQAQA
GISGFPCYETVEESYAIAEQLVRDYPNYASWQPIGPAWAKSNGRPGYDLHVLKLSKNNGV
ANKPVLLINSAIHAREYATAPLMLAFAKSVLEGIGNNADADWMLEQQEIHLLLQTNPEGR
KIAEGGLLWRKNINDASCSSGNYGVDLNRNFSFGWNSAPGGSSGDSCDLTYRGVSAGSEP
ETQALQQYARAVFKDNRGPLRSDAAPATTSGIHLDIHSYSELVLWPWGENASPAPNAAAL
QTLGRKFAWFNDYLPTQSIGLYPTDGTTDGVSYGELGVAAYTFEIGTAFFQSCAVYQNQI
LPDNLKALWYAARVTAAPYLLPSGPEVQGLTMNTVDGKVRQDQSLTLQFQLTDRQTNLQN
GIEPSQPISKAELFINQFPTESATADVVLSAQDGAFDNAVEMVNGTLTSLPLGKHRLYLR
GTDASGQAGPVYASYVEVTPAQEDPLISLDFSVQCQFLRCSFRNLSQIATGSNLVFSWQF
AAGQSSQSAAPEFVFSAAGSYPVSLSTVSLGQPRVVTKTVTVFAEPQVSFSSSCNNLVCD
FTASASSGNGAIVQYNWQLGSVVASGNPLRFTFSGAGSYPVTLTVQDAAGQQANSSQTLT
VTAPPPPPPAAAGKSSGGSWPAVFSLGLWWLYLARRHRSCR
Download sequence
Identical sequences A0A1B7UFA2
WP_068070033.1.81126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]