SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_068345837.1.99413 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_068345837.1.99413
Domain Number 1 Region: 83-364
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.0000000000000245
Family 4-alpha-glucanotransferase, N-terminal domain 0.056
Further Details:      
 
Domain Number 2 Region: 477-599
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0000000000816
Family alpha-mannosidase, C-terminal domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_068345837.1.99413
Sequence length 902
Comment hypothetical protein [Kosmotoga arenicorallina]; AA=GCF_001636545.1; RF=representative genome; TAX=1453497; STAX=688066; NAME=Kosmotoga arenicorallina S304; strain=S304; AL=Contig; RT=Major
Sequence
MKRILFEGNGITLEVLITDLISIQDKRLMIFKSNSRGVLKVFSSGDLLSDAVLENNSIEL
LIDNVDEIELLFNSPAMEFRKKLKLPSPKRLELHLLMFSHSDLGYTAPLSKVEELQYQYT
STALNFYEKSLKYSEASRFRWNVETTWALNCFAERANRSELAKFTDLAKKGEFGIGAIYL
HHYTDRTPFEELYHSLNPLRRLIKKGIEPKSAFLSDVPGCSEGFLELLAAHGVENLFMSI
NNFVAPFLEFTHLKTPFWWKLKSGRRILTWFTHDPKYAYIEGYKFFDKDYKTLKESILNK
YEELSELSYEFPLYPIPMAIDNMPPVFKPVELIDRWNKEWKNPIVKTSVIDDFFKALRRE
LETTRIDSTKGNFNGWWTSNVLAYPRENRLSTISFAQLHEASALDSFSGSFIENAINDEF
IRLSGFDEHSGGGGLYLSKDPEDILKAVSEGYGWVVKTHKHSSEILKALRENIFGIGNKL
VVFNPVAMERNTLASFETDEIRGKRVKLIDLSTGESMPILCYNDLVIFETGTIESFGYKC
YSLEIESEAEMPKWHSGSITLENDYYRIEFDEYGNIRSLIDTQTRKELVLNERSLGKFLV
ARQAINPADNLVNAINHDELYTGKSSSKLVEPYLPVKCHWKMIKGTAGTLVIFEPESPFI
KPFVKAYLIPKNLKEIRIHLRINYVYDIGPSDFMYLEMPFNLDRPKAFYKSPGEISEITE
QIPGSALDAITTVGGIELKTKEQSIQIGLCGINLVDFGEPSPLTFKKEINVSGELFLRLF
NTNLQNRFASPYFNGEPIEFDVLLTTGGKLSRVEKDALFPLTAFKASPKANTNCFLECRG
LENSEFLFIESEKGKLNFAIKETAGEKREIFIKNPRTNTVFKRIIKPFEFFKGSVENEPY
KS
Download sequence
Identical sequences A0A182C7G1
WP_068345837.1.99413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]