SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_068407521.1.35051 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_068407521.1.35051
Domain Number 1 Region: 537-808,843-949
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.73e-37
Family alpha-mannosidase, C-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 118-294
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000000889
Family alpha-mannosidase 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_068407521.1.35051
Sequence length 970
Comment glycoside hydrolase [Pedobacter cryoconitis]; AA=GCF_001590605.1; RF=representative genome; TAX=188932; STAX=188932; NAME=Pedobacter cryoconitis; strain=PAMC 27485; AL=Complete Genome; RT=Major
Sequence
MGTASKRHLFKLLAIVFLTVSSFNVFAQKAKAIFTAIQVQPTIAYLKYQGERRRMVRLIF
KNGKNYQQAEISVSFNNLTEKINIPANKQGAESLEIPLPGIPVTKATQATVSIAVNHQTY
TARCIVEPSRSWNIYVLPHSHVDIGYTNTQSKVLKLHLDNIDESIALAEKTQHYPVAARF
KWTTEAMWVVDNYLALANQEKKNRFWNAVKKGWISLDGAYGNINTSLTDSRQLMQMFAKS
QQLAKEQGLEINTLFQGDVPGASWGLAAQVEQTGIKYFLSGPNASDRIGNLAKWQDKPFY
WLSPSGKQKLLFWQCQPYSLGYQLKGDKIPNFFTIKDPKPFYTGHPSENFLNPYLFDYLD
ELAQKGFPYDMSILTWAMSDNAPIDPELPDAVKAWNEKYASPQLIITSTKQFFTDFEQKY
AAEIPSFTGDYTEYWTDGVSSAAKETALSRKLSDQLKQADAVWAIRNKSAYPVQSFDESW
KNLLLFNEHTWGAYNSVSHPDDEKVRSQWAVKQSYVLKAGDIIDTLSQLSLKSELSKANQ
IDVYNTVSWPRTDLVYVPASLSKRGDLVKNSSGKPVLSQRLNTGELAFIAEQVPQMGKST
FSIFAGAAYRKGSETNQISSNTISNGIYKIELAPQTGDIKKLIKISTNRNYLSADSAGLN
QYLYMPGDSIEKIQSSSNARITIKEKGPLVNSLLITSAAPGTNGITREIRLISGLDKIEL
INTIDKKAIRTKESVHFAFPFHIPDAKVRYSIPWGSITAETDQLPYSNRNWYTMQRWIDL
SNNTYGVTLSSPDAPLFEIGKITTANLLGGLPHAPLWLSFTPQSSHIYSWVMNNLWHTNF
RADQQGMVTFRYFIQAHEHGYDSYQANQTGLSNHQPLLVAPAAATLEKGLPFTVNGTHTY
VEAIKKSDDGKGVVLQLVNCGDQDSQINISPKNNSSVTIWESDLLETRKKLLKNLFTLSA
KGIMTIYIEN
Download sequence
Identical sequences A0A127VE72
WP_068407521.1.35051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]