SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_069215260.1.14081 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_069215260.1.14081
Domain Number 1 Region: 658-936,976-1072
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.57e-28
Family alpha-mannosidase, C-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 272-556
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000556
Family alpha-mannosidase 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_069215260.1.14081
Sequence length 1097
Comment glycoside hydrolase [Elizabethkingia meningoseptica]; AA=GCF_002002525.1; RF=na; TAX=238; STAX=238; NAME=Elizabethkingia meningoseptica; strain=61421 PRCM; AL=Contig; RT=Major
Sequence
MTNSLMYAQKKVPFFGSIQSVNGYATEISGENIDYFSAFPDHATRALLTRATDGAKTIEW
ETAPAPQKITAPYVYFSWLVSHSSGSSGGIRNFDLYINNQKSLTLTTYPANQKPNWIAKA
ADSTAFVFNQTKMDGLKDSYGIAYLRIPTSKVTPGKSIRLKIVGQAQDSRDWFMTYKFTF
EEKMDAASTPFILKDGKRLITLTTLHFGPEQKITATIDNKENFSFTMPDGIKTFDIPVTL
SSKGGSVALTVTSGSKQLLHKTIQAGPVVPRTLYFIHHSHTDVGYSHLQSEVEKIHTKNI
YDALKMIEETRNLPEEARFKWNVEALWDVENFMQKATAEEKKSFVKAVKEGNIGLSAMYA
NILTGLSQPEELFHYTEYAQKLEKEYGLNITSAMMSDVPGFAWSLVPALTSSGVKYFSSG
PNYLGKTNPYLGDRVGNFVKNWGDKPVWWESPSGKEKILFWTAGRGYSSWHGIHPGAVFE
NGQKKIAEYLEDLTKTNYPYDIVQWRYNIVSDNGPIDPSISKFVDEWNKKYTSPKIVLST
NEKMFEVFEKKYGDKIPVVKGDISPHWEDGAMSTAKEEGLNRNSSLKLQQLTTLYSMLNP
GQYNNQSFYEAWRNVILFHEHTWGAFNSITAPDLPFVTDQWKVKKQFSLDGSTLANKLEA
DLLQPLTDPASNIIAVYNTSSWVRDGLVILPVQAQANAVQDLKGNKTPLQKLENGTMAFI
ARNIPPLSSATYTIIKDSSPKTSVFSITDHSISNGKINLTWDNKTGSITHFTDNNGTTNY
AGTFNNQGLNSYWYVPGTNPQDAQSNTNVQVKVLENGPVLAKISLTSEAPGAHRLEKIIT
LISGSDEVTLENIINKKPIRTKESVHFGFPFNKEFKNITADAGYGVMKYLTDQLPGSNMD
YWYSRRWVDASFGQKGMQWMLLEAPLIEAAEMIDERLQIDNSHKKWKDKGTPGTTNWFSY
AMNNYWHTNYKADQEGPVHYHYALRPHGAFNSVENEKYAAAFTQPLIAIPVNKKATVKGS
LFHMNNDKIVVTTITPQEDHSFIIRLYNPDEKEQSTAFIWEQLKPSKLIHLKTEKTISIN
DTISLNGMDVIEIKAIP
Download sequence
Identical sequences A0A1V3TWQ0
WP_069215260.1.101133 WP_069215260.1.14081 WP_069215260.1.22355 WP_069215260.1.29032 WP_069215260.1.32675 WP_069215260.1.38129 WP_069215260.1.39567 WP_069215260.1.41171 WP_069215260.1.54869 WP_069215260.1.56928 WP_069215260.1.76836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]