SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_071134078.1.4219 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_071134078.1.4219
Domain Number 1 Region: 537-964
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.04e-32
Family alpha-mannosidase, C-terminal domain 0.018
Further Details:      
 
Domain Number 2 Region: 122-319,361-429
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.000000000000322
Family 4-alpha-glucanotransferase, N-terminal domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_071134078.1.4219
Sequence length 965
Comment glycosyl hydrolase [Millionella massiliensis]; AA=GCF_900104655.1; RF=representative genome; TAX=1871023; STAX=1871023; NAME=Millionella massiliensis; strain=Marseille-P3215; AL=Contig; RT=Major
Sequence
MIRRKIGALLFASVLSSAVYADVRPTTVDCVVRPVYGYRADGTPGRIVKLKLKGTELNGE
LKIDVVAKGAKESNRFTIAAQDSTELELMLPSTLPTDQSTVVTLMVRGNGPTLKRQINVS
PMRHWNVYLYNHAHVDVGYTNTHKNVEILHKTNVVEGIKLAEETKNHPDGSRFVWNPEVG
WPIERLWESRPEYRDTLINAIRKGQICVDASYLNLNTSTCSDEELFHVFRFTRLMQRLSG
QPADVFQQFDIPGMSWGLIPVMAQEGVRYIISWPNSDRAGHAHKNLDGKPFWWVGPDGKS
KVLFFQPGQYANSGSMTKGGTTGRPWFGQRDPKKVPPVIRTGSANVDFTGKLEAMEKEGY
PYDFAVLSWSLWDNNPLDADVPFAVKEWNEKYAYPKIRICGGHEIMSMIEEKYGDQLPVV
TGDYTEYWTDGLGTAADLTARNRRAKERLVQAETVWSMLAGGAKAPRADFDEAWRYILLG
SEHTWCFENPTEPYFQDAIWKVKQAYFHEAEDRSIDMLNESLAPATEKSNGALGPKEGPA
NGGIAVFNTHSWPQSGVVRLSASESLKGNKVVNEKGEEVLAQRLSTGELLFFAADVPALG
SRHFRVVEGECSLTGPCRIDGTTLENGALNVHIDPASGNLVSLTKKGADYNYIDQGANTF
AWLPANEDAPRGDTVVSVEVVENGPLAVELRVSSKAHGCRSVSRSVRLLANQPWVELSNV
VDKLPWVAKDGIHFGFSFNVPQAQTRVDIPWGVMEVEKDQWPQANRNWLAMQRWLDVSNA
THGVTWCSLDAPLFEYGGRHANIAMGWGSQGNWIERLDPSATVYSWVMNNHWHTNFPLTQ
DGPVEFRYRLLPHDGYDVVEANRFGMEQAQPLVYVTADKDPQVQAVVGIDNPKVYSTIVK
SLDRDNALIVRLRSVSDKAENVTVSFPGKKPARMAVCELEEVAGQQTDGRLTLDPYGMVT
LRLEY
Download sequence
Identical sequences WP_071134078.1.4219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]