SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_071134133.1.4219 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_071134133.1.4219
Domain Number 1 Region: 532-938
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 9.1e-29
Family alpha-mannosidase, C-terminal domain 0.0045
Further Details:      
 
Domain Number 2 Region: 121-361
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.00000000000000311
Family 4-alpha-glucanotransferase, N-terminal domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_071134133.1.4219
Sequence length 967
Comment hypothetical protein [Millionella massiliensis]; AA=GCF_900104655.1; RF=representative genome; TAX=1871023; STAX=1871023; NAME=Millionella massiliensis; strain=Marseille-P3215; AL=Contig; RT=Major
Sequence
MKRTLILMISALWCIQGASAAVQTGEAFIEVKVSDRYKYRDDGKPGREVFVDYRGPRQLR
SGKFRIVSRQGTETVAFTTQRNDSIPLLLPEGIGVSARDTVTIALMAGREQCECRTVVPA
MRHWTVYIYPHSHVDIGYTNTQQNVEFIHKRNLEVAMELAEQTRNYPEDARFRWNPEVTW
PIERYMASAPEAKRQRLLDAIRRGDIAVDAGYVNTNTSACSDEELLELFRYGKELERQTG
VKVETMVQVDIPGMSWGVVPAANHYGIRYCLSLFNGYDRTGLSSMLNFKPFWWIGPDGVS
KVLFLQPGSYTPGALAKGKDFWPLMAGQTDTSKLLRVVRTDNPRANFIDGYLAEKLPQLE
ADPEYIYPIFPMTWCMADNTPIDVDLPEAVRSWNEEYAFPHLKICTGTEMMEAFAAYGDR
IPQMKGDFTEYWTDGLGSGAAKTGRGRVVKETLVQAEILWAMLHPGEPMPDETYREAWRN
IILSTEHTWAFMQPDKQPISDEINRTKYGYFDRAAELTDRAVEMAVAGVAKEGADRIAVF
NTNSWPQSGLVRLSAERSAAGDRVTDAAGRVIPSQRLTSGELVFVAEEVPALGSAIFRLS
AGPKTKPATVADSAYVLDNGRVRLTLDPLTGDVVSLIYGGAEYVDRAALVGWNSFRYLKG
GQTTGSATKPVNVRIIRKEWGPVVQSFRVEADAEGCEGLTREVMLLNGSETVYFRNVVDK
RAVLDKEGIHFGFAFDVPQGVTRVNVPWGVMELEKDQLKAANRNWIAMQRWLDISSADKG
VTWCPLNAVNFESGDMTANIIGGATGSPEWIRQLRPSSIVYSWALNNHWHTNFPLSQSGK
ITFEYRVRPHAGGYDAASANRFGMESFRPLVAVPVGENFTGIARPVTLSGADEVFLSTYR
TIDRDRSLVRLLSQSGSDETVALRFGAVRPASVVAVTEDSQGERKTVSPDAIVIPANGSI
TLEINWR
Download sequence
Identical sequences WP_071134133.1.4219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]