SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_072992101.1.51982 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_072992101.1.51982
Domain Number 1 Region: 571-977
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.2e-31
Family alpha-mannosidase, C-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 152-329
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.00000000000378
Family alpha-mannosidase 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_072992101.1.51982
Sequence length 1001
Comment hypothetical protein [Pseudozobellia thermophila]; AA=GCF_900141855.1; RF=na; TAX=192903; STAX=192903; NAME=Pseudozobellia thermophila; strain=DSM 19858; AL=Scaffold; RT=Major
Sequence
MVSIKNMKSILRLKVALILLVSTNSIQSQVDVTKVENNLTGKVYTDFAAMQDKSRIDIEL
SAALRLIVQPYYGYLKNGDPGREINLVLNEKGKSGKVKIELEALGQKESFTFNLSEDITE
YKFLLPAGIGVTTDDKVDVTISGSGLNVSKTITIPKKRQWTIYLYPHSHVDIGYTNTQKN
AEIIHSRNLVNGIELAEETANYPEGAGYLWNPEVLWPIERYLGNATPEEKREIIDGVRKG
YIRLDAGYANIMTSAASDEELIEFFRFKTHYEKLTDKPIETLVQVDVPGMSWGIIPVAVK
KGIKYIFSFNNGTGRVGQSIKQSFKPFWWADESGKNKVLFYQAGSYNPGALIKGHQFWPA
MAGQTDPSKLLDIVKTENPRENFIDGYINKILPELEDSTDYPFDIFAMSWAMADNTPIDA
DLPEAVKSWNSEYAYPHLIIAGATDFMKAFDDKYGNEIPIVKGDFTEYWTDGLGTAAKYT
AMNRTTKERLVQAETLWSMLQPGKPAPSSIFNEAWRNVILGTEHTWAYMAPNEQPLSDEI
LKVKLDYFTSAEKLSHDLLNKALATVGKAQSSNFGVFNTLSWNRSGIVKIPKEQAKGFNS
VLDEDGNSISSQKLSNGELIFLANDVPAFGSKKYKLSHKKNRVKLKIAKENVLDNGLVRV
SIDTITGDIGSIIRGGKEFVKLHGNSKVNTYKYLHGDDSPDKATSTTSVKYHILENGPLM
AKIAVDSEAEGCNSLLREITLYKDQAHIEIKNTVDKIAITDKEGVHFGFAFDIENPKMVS
DIPWGTMEIEKDQIPGANKNWITTQRWVDISNDKSGVAWTSLDAPLFEVNDITANILGSA
SGSNQWISSLEPNGTIYSWALNNHWFTNFPLSQEGSIVFRYAILPYNTMGDLASSNRFGL
EQFRPLVVSSLKDDFRPQQILSIEGNTAVTASVLKPSSDGKSALLRIRSISKKDELVKLN
WHENKPSSVSIYDINDNTIKDKIDDSLMIPAMDFVTLYVVW
Download sequence
Identical sequences A0A1M6GE23
WP_072992101.1.51982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]