SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_073082836.1.75329 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_073082836.1.75329
Domain Number 1 Region: 675-945,985-1069
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 6.91e-31
Family alpha-mannosidase, C-terminal domain 0.008
Further Details:      
 
Domain Number 2 Region: 287-433
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.00000000712
Family NodB-like polysaccharide deacetylase 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_073082836.1.75329
Sequence length 1093
Comment glycoside hydrolase [Chitinophaga jiangningensis]; AA=GCF_900142605.1; RF=representative genome; TAX=1419482; STAX=1419482; NAME=Chitinophaga jiangningensis; strain=DSM 27406; AL=Contig; RT=Major
Sequence
MKKIITGITAAVLGLCMQTSAQKTVPYFGTINWINGYEKEISGENIQYYSAFPDYATTAL
LTRTTDGNKTIEWQTGKVPANSKGQYVYFSWVAGHSTGTSSGPRNFDLYVNNRKTLTFTT
LPGNQSPVWSYAAADSSRIVFQQTARDGASDAHGLMFLRIPVSVTTPGKPVTLRITGQAQ
QSNDWFMTFKFAFQEKVDLLPQPFLLKGGKQPIALTALHFGTPETLQVKVNNLQVATYNI
KDGINRFDIPVTAVKQKDSVHIVVSNGKKVVADKFVTLLPVTYRELDLIHHSHTDIGYSH
MQPEVLKIHLKNIDDALQMIAATRNYPVEARFKWNIESLWAVENYMLQASPEKKAAFIKA
VKEGSICLSALYANILTGLSLPEELFHYTDYANQLKKEYGLQIPSAMISDVPGYTWTTVT
ALAHGGVKYFSSGPNYLGENHPYLGDRVGHFVRTWGDKPVWWASPSGEEKILLWTGGKGY
SSWHGTAPGGVFDRGPQKIATYLRELDAKKYPYDIVQWRYNIVADNGPIDTAISRFVMEW
NEKYQSPKLVLNTVDKLFKTFEDRYGKQLPVVKGDITPYWEDGAASTAAESGKNRVNSLR
LQQLTNAWAVLQPGTFPQQDFYRAWTNVIMFHEHTWGAHNSISQPDVPFVTGQWRIKKQF
MLDADSITGQLESALLKSFTDNNSKRIAVVNTLSWARTGMVKIKVPGKSVIDSKGKAWPL
QQLQSGEYVFMAREVPPLGTAVYEVSDKPVKATSVFKQSGNTISNGIITVSWDANTGSIT
SLSAKDQYNYAGTFGNQGLNSYWYVPGMDPAKAESNSGITAQVLENGPVVTTISLTGNAP
GANSINKKITLYADAGEALIENIVDKKPVREKEAVHFGFPFNISNPKTTLDAGYGTLRYL
DDQLPGSNMDFLFGRRWLDVSNNDRGIQWMLLETPMVEPQQMIDERKVIDQSHKEWRKTG
TPTATWFNYIMNNYWHTNYKADQDGKSSYSYALRPHTGNTATAQEQAAAAFTQPLLAFPA
RKDLHLPENLFRISNTHIIITSVTPLDNNRYQVRLFNPESSRQQGRFVWGSFTGKDMEVD
LPGMGVKEVIVSK
Download sequence
Identical sequences A0A1M7F7X4
WP_073082836.1.75329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]